Details for Lyrate rockcress Locus 16058027

Position : sca3 ( 5`- 2227437 .. 2229252 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896672 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058027

Protein [Map View]
MASSNTTTGVDNTFRKKFDEEEFKERAREREKKESDRSKSRSKGPPVQRAPLKHRDYHVDLESRLGKTQVVTPVAPLSQQ
AGYFCRVCDCVVKDSANYLDHINGKKHQRALGMSMRVERSSLEQVQERFEVLKKRKTPGTFTEQDLDERIRKQQEEEEEL
KRQRREKKKEKKKGKVMEEEPEMDPEVAEMMGFGGFGSSKKS*

DNA
ATGGCTTCGAGCAACACGACAACTGGGGTTGATAATACGTTTAGAAAGAAGTTCGATGAGGAAGAGTTTAAGGAGCGTGC
TCGTGAACGCGAAAAGAAGGAATCGGATCGTTCTAAGTCTCGGTCCAAAGGTCCTCCTGTGCAAAGAGCCCCTTTGAAGC
ATAGAGATTATCATGTAGACTTAGAATCTCGTCTGGGCAAGACACAGGTCGTTACACCGGTAGCTCCTCTAAGTCAGCAG
GCCGGTTATTTCTGTCGAGTCTGTGATTGTGTTGTTAAAGATTCGGCAAACTACTTGGATCACATAAATGGGAAAAAACA
TCAAAGGGCATTGGGGATGTCTATGCGGGTGGAGAGATCGTCACTTGAACAAGTCCAAGAGAGGTTCGAGGTTTTAAAGA
AGCGGAAAACACCAGGAACTTTCACAGAACAAGATCTGGACGAACGCATCCGGAAACAGCAAGAAGAAGAGGAAGAACTA
AAAAGGCAGCGTAGAGAGAAAAAGAAGGAGAAGAAGAAAGGGAAGGTGATGGAAGAAGAGCCTGAGATGGATCCTGAAGT
TGCAGAGATGATGGGATTTGGGGGCTTTGGATCTTCAAAAAAATCATGA