Details for Lyrate rockcress Locus 16058025

Position : sca3 ( 5`- 7262476 .. 7258522 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058025

Protein [Map View]
MGDSNGASLIEIDDQEEVEDPFLAFIDYARTIISPEEDEDEKDESKRDPSEAMTEAGGPGWGWVASRILKTCTAYSSGVT
AAILLSDLSQAWHEQNKPGMSKKKPELIDQLKKSHRRRRLANTVTIDSIYEKNFLSMNSVLEAVIINADVLPGTNIFMLT
LGDFWSSNTIDLYLHRRYYELVETPNGILRKGREVLITGCYLRTAREGFGTPRLLPTEYLVVLLDEDQDDDAILIAAQFF
SDTFSSVSLDSFNDGTSYSLYARIESIGPLESELTFSTAHRRQISLVDGDGDRLKFILWGEQVIVANLLSVGSFLGLERP
YISSLEESAMEGKDEFCLEYGSATHLYLVPSTLQEERVCVALSQHQCQGSKLLGSVGVSQVTLPRDADGSIDFSNYPFRT
IITDIRDKTTGISLYGVVTDISCDPNATGVVYSLKIEDTTGAIWAKLHFTNYWSVGRLGLGHVVYVSGLSCKITKENYLI
NINGILVFELYVLFHLYTSLIHLDKIDQCHNINTRLAHSLCGHFIDEESSSSSSSSSLHCSFCRVSCNNNTGSEVVRTFH
ITITLADEETRLYAWCTGQSAAAILQISPDEFYDLPEDDRLMYPSLENEWFLVTLANSGSRNSGPGHETEATCWEITRAL
KI*

DNA
ATGGGGGATTCAAACGGAGCATCGCTCATTGAAATTGATGACCAGGAAGAAGTAGAAGATCCATTTCTGGCTTTCATCGA
CTACGCCAGAACTATAATTTCACCGGAAGAAGACGAAGATGAGAAGGACGAGAGCAAGAGGGATCCCAGCGAAGCCATGA
CTGAGGCAGGTGGTCCCGGTTGGGGCTGGGTCGCCTCGCGTATTCTGAAAACCTGTACCGCTTATTCGAGCGGTGTCACT
GCCGCAATTCTGTTGTCTGATCTCTCTCAGGCATGGCATGAGCAAAACAAACCAGGAATGTCAAAGAAGAAGCCGGAACT
CATAGATCAGTTGAAGAAGAGTCACAGAAGAAGAAGACTCGCTAATACTGTCACAATAGACTCGATTTATGAGAAGAACT
TTTTGTCCATGAACAGCGTTTTGGAAGCTGTTATTATCAATGCTGATGTTCTTCCTGGTACAAACATATTCATGCTTACA
CTAGGGGATTTTTGGAGCTCCAACACCATTGATCTCTATCTACATCGCAGGTATTATGAGTTGGTGGAAACACCAAATGG
GATTCTTCGGAAAGGCAGAGAGGTTTTGATCACTGGATGCTACCTTCGTACCGCGAGAGAAGGATTCGGCACTCCACGGT
TACTTCCAACAGAGTATCTTGTCGTATTACTAGATGAGGACCAAGATGATGATGCAATCCTCATAGCAGCTCAATTTTTT
TCCGATACTTTCTCATCTGTTTCTCTTGATTCTTTCAACGATGGAACTTCATACTCTCTGTATGCTAGGATTGAATCTAT
AGGTCCTCTGGAATCTGAACTCACGTTTAGTACTGCACATAGAAGGCAAATTTCACTTGTAGATGGTGATGGCGATAGGT
TGAAATTTATCTTGTGGGGAGAGCAAGTCATTGTGGCAAACCTTTTAAGTGTGGGAAGTTTTCTTGGGCTTGAGAGGCCT
TATATTTCTAGTCTCGAAGAGAGTGCAATGGAAGGAAAGGATGAGTTCTGCCTTGAATATGGTAGCGCAACACATCTCTA
TCTAGTGCCATCAACCTTACAAGAGGAACGGGTTTGTGTAGCATTGTCACAACATCAGTGTCAAGGATCTAAACTGCTTG
GTTCAGTCGGAGTTTCGCAGGTGACATTGCCTCGTGACGCCGATGGGTCTATAGACTTCAGTAATTATCCTTTTCGGACG
ATAATAACGGACATTCGCGACAAAACCACTGGCATCAGTCTTTATGGGGTTGTCACAGACATTTCATGTGATCCAAATGC
AACAGGAGTGGTCTATTCTTTGAAGATTGAGGACACAACTGGAGCAATATGGGCTAAGCTCCATTTTACCAATTACTGGT
CGGTGGGAAGGTTAGGGCTTGGTCATGTCGTGTACGTGTCTGGGTTATCGTGCAAAATCACAAAAGAGAATTACTTAATA
AACATTAATGGAATTCTTGTTTTTGAGCTTTATGTGTTATTTCATTTGTACACCTCACTCATTCATCTGGATAAGATCGA
CCAATGCCATAACATTAACACTAGATTAGCTCATAGCCTTTGCGGCCATTTCATAGACGAAGAATCATCATCATCATCAT
CATCATCATCACTGCATTGCAGTTTCTGCCGAGTAAGCTGCAACAATAACACAGGATCAGAAGTAGTGAGAACATTCCAC
ATAACGATAACACTTGCAGACGAGGAAACCAGACTATACGCGTGGTGTACTGGTCAGTCCGCAGCAGCTATACTTCAGAT
ATCTCCTGATGAATTCTATGACCTCCCTGAGGATGATCGGCTAATGTATCCGTCATTGGAGAACGAGTGGTTTCTAGTGA
CCTTAGCAAACAGCGGTAGCCGGAATTCGGGTCCCGGTCATGAGACGGAGGCCACTTGCTGGGAAATCACACGCGCTCTC
AAGATTTAA