Details for Lyrate rockcress Locus 16058002

Position : sca3 ( 5`- 1357648 .. 1354603 -3` )
Annotation : [B2G] ATAPY1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058002

Protein [Map View]
MTAKRAIGRHESLADKVHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKKHEGGSNSRGPKNYAVIFDAGSSG
SRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRALGHQ
ASENILQAVRELLKDRSRLKTEANAVTVLDGAQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAAT
APKPLEGEDSYVKEMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVTGFAGTYKYGGKAFKAAAAPSGASLD
ECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDRAAEAGFVDPKQPVAEVRPLDFEKAANKACNMR
MEEGKSKFPRVEEDNLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSSP*

DNA
ATGACGGCGAAGCGAGCGATCGGACGGCACGAATCCCTTGCTGACAAGGTCCATCGACATCGTGGTCTTCTACTTGTGAT
TTCGATTCCCATTGTGTTGATAGCTCTTGTGCTTCTGTTAATGCCGGGGACGTCGACGTCCGTCTCTGTCATTGAATACA
CGATGAAAAAACACGAGGGAGGTTCGAATTCCAGGGGTCCCAAGAATTACGCTGTGATTTTTGATGCTGGTAGTTCTGGA
AGCCGTGTGCATGTTTACTGTTTCGATCAGAATTTAGATCTTGTTCCTTTGGAGAATGAGCTCGAGCTCTTCTTACAGCT
AAAACCGGGTTTAAGTGCATATCCTAATGATCCTCGGCAGTCAGCAAACTCTTTGGTATCTCTTCTGGACAAAGCAGAAG
CTTCTGTTCCTCGTGAGTTGCGTCCAAAGACTCCTGTCAGAGTTGGGGCAACCGCAGGTTTGAGGGCTTTGGGTCACCAA
GCCTCTGAAAACATTTTGCAAGCGGTTAGGGAGCTCCTGAAAGATAGAAGTAGGCTGAAGACTGAGGCAAATGCAGTGAC
TGTTCTGGATGGTGCTCAGGAAGGATCTTATCAGTGGGTGACAATTAACTACTTGCTAAGGACTTTGGGAAAGCCGTACT
CGGACACAGTTGGAGTGGTTGATCTTGGAGGGGGGTCGGTTCAAATGGCGTATGCTATACCAGAGGAAGATGCTGCAACT
GCACCAAAACCTTTAGAAGGCGAGGATTCTTATGTCAAAGAAATGTATCTGAAGGGACGAAAGTATTTCCTCTATGTTCA
TAGCTACCTACATTACGGGTTACTGGCTGCTCGGGCTGAGATTTTGAAAGTCTCTGAGGACTCTAACAACCCCTGTATCG
TGACTGGCTTTGCTGGTACCTACAAATATGGAGGAAAGGCGTTTAAAGCCGCAGCTGCTCCATCCGGTGCAAGTCTAGAT
GAATGCCGGCGAGTAGCTATTAACGCACTCAAAGTCAATGATTCACTGTGCACACACATGAAATGCACATTCGGTGGAGT
ATGGAATGGTGGAGGCGGTGGTGGCCAGAAGAAAATGTTTGTTGCATCATTTTTCTTTGATCGAGCTGCAGAGGCTGGTT
TTGTTGACCCAAAACAACCTGTGGCTGAGGTTCGACCACTTGACTTTGAGAAAGCGGCCAACAAAGCTTGTAACATGAGA
ATGGAAGAAGGGAAATCGAAGTTCCCACGTGTGGAGGAAGATAATCTGCCTTACTTGTGCTTGGATCTTGTTTACCAATA
TACTCTTCTGGTCGATGGATTCGGATTGAAGCCATCACAGACAATAACGTTAGTGAAGAAGGTGAAATACGGAGATTACG
CCGTGGAAGCTGCGTGGCCACTAGGAAGCGCCATAGAAGCAGTATCCTCACCATGA