Details for Lyrate rockcress Locus 16057865

Position : sca3 ( 5`- 10592385 .. 10591623 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057865

Protein [Map View]
MKMSINKVKSMICTTLTKSMPAIAFFGRMTFSFVFLITAIQDYADHYGDGGPIEKTMGPAVNVLSKYGSKALTFYFGMQV
VAFDVRLIEFALISAKATGALWFIFGQSIPAYFLLATQIFSTVIPFPTNLNDFTQNLTLIGALLYYIGLKHTIDNLDEEQ
KNKENEAEG*

DNA
ATGAAGATGTCAATTAACAAGGTCAAGAGCATGATCTGCACAACCTTAACAAAGTCAATGCCAGCCATTGCCTTCTTTGG
GAGAATGACATTTTCCTTTGTCTTTCTCATTACTGCTATCCAAGATTATGCTGATCATTATGGCGATGGCGGGCCAATCG
AGAAGACGATGGGACCAGCCGTGAACGTGTTGTCCAAATATGGTTCAAAGGCACTAACATTTTACTTTGGAATGCAAGTG
GTCGCATTCGATGTTCGACTTATTGAGTTCGCACTCATAAGTGCAAAGGCAACCGGAGCTTTATGGTTCATCTTTGGACA
ATCCATCCCAGCTTACTTCTTGCTCGCAACGCAAATTTTCTCAACTGTTATTCCTTTCCCTACCAACTTGAATGACTTCA
CTCAGAACTTGACGTTAATCGGGGCGTTGCTATATTACATTGGATTGAAGCATACTATCGACAACCTCGATGAGGAACAG
AAGAACAAGGAGAATGAGGCAGAAGGATGA