Details for Lyrate rockcress Locus 16057859

Position : sca3 ( 5`- 4600216 .. 4598471 -3` )
Annotation : [B2G] 4 -phosphopantetheinyl transferase family protein
External links : CoGe
PGDD synteny : 16057859

Protein [Map View]
MRISVISQLQRSFSMEFPSLVSLKLPSPMETHLWYIRPDEVKIPSLLKHYSQLLSPSEIDKVSQLRGDQLKKNALLARTL
VRTTIARYQTNNAVDPRSLMFKKNTYGKPEVDWQNYKNCNIPPLHFNISHTDSLIACGVTVHVPVGIDVEDKERKIKHDV
LAFAERFYSADEVKFLSTIPDPESQRKEFIKLWTLKEAYVKALGKGFSAAPFNTFTIQSKAGTKGEYNLCKTSEMTTSSL
EKTNNCNGEWKFSLLELADSHYAAICIEDDQASGGAPMRVIVRKTIPFVEDELISESILL*

DNA
ATGAGAATCAGTGTCATTTCGCAATTGCAGCGAAGCTTCTCAATGGAATTTCCATCACTCGTTTCTCTCAAACTTCCATC
TCCAATGGAGACTCATCTATGGTATATTCGACCAGATGAAGTGAAAATTCCATCTCTTTTAAAACACTACTCTCAACTTC
TGTCACCATCTGAGATAGATAAAGTTTCTCAGCTTCGAGGCGATCAGCTTAAGAAGAATGCTTTGCTTGCTCGAACCTTG
GTTCGGACCACCATTGCAAGATATCAGACAAACAATGCAGTCGATCCTCGGTCCTTGATGTTTAAGAAGAATACCTATGG
GAAGCCTGAGGTAGATTGGCAGAATTATAAGAACTGTAATATCCCACCATTGCATTTCAATATCTCCCACACAGATTCAT
TAATTGCCTGTGGGGTGACTGTACATGTTCCGGTTGGTATCGATGTTGAAGACAAGGAAAGGAAGATTAAACATGACGTC
TTAGCATTTGCAGAAAGATTCTACTCTGCTGATGAAGTGAAATTTTTGTCAACTATACCGGACCCTGAAAGTCAGCGAAA
GGAGTTTATTAAGTTATGGACTCTAAAGGAGGCATATGTGAAAGCATTAGGAAAAGGCTTTTCTGCTGCACCTTTTAATA
CCTTCACAATCCAATCTAAGGCTGGAACAAAAGGGGAATACAATCTTTGCAAGACATCTGAAATGACTACCAGTTCACTG
GAGAAGACAAACAATTGCAACGGAGAATGGAAGTTTTCCCTTTTGGAGTTGGCTGATTCTCATTATGCTGCAATCTGTAT
TGAAGATGATCAAGCTAGTGGAGGAGCTCCTATGAGGGTGATTGTTCGAAAAACCATCCCGTTTGTAGAAGATGAACTTA
TTTCTGAAAGCATACTTCTTTAG