Details for Lyrate rockcress Locus 16057855

Position : sca3 ( 5`- 12215564 .. 12216715 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057855

Protein [Map View]
MSDNNPEIESSTFNTLNHDVTESILSHLPIPSLVRFTLVSKQWRSIITSLPPSPSPSSSSPPWLFLFGIHNTSSFHNQSF
AFDPLSNTWLRLPPSSSSSDHLVGSNRFLFTTAPRFSFSPILKPNWRFTSPVLFPRINPLLSVFTTLSNSSKLILVGGSS
RIGGLVDIEERLAVQVYDPVLDSWELCSPLPADFRSGQDHQTLTSALFKRRFYVFDNYSYFISSFCLDSYTWSDVQTLKP
PGLSFAFLNSCNGMLVLGGMCGFSFNLWSIEEGSMEFSEIAVMPEGLLFGLVDNEDEEDKFRSLKCVGSGNLVYVFNDDC
HKKFPACVCEIGGGENGKCSWRRVPCLPSPVNKFHKVVSFCSTVSISDVFHPEDAHIGG*

DNA
ATGTCAGACAACAATCCAGAAATCGAATCATCAACCTTCAACACTCTAAACCACGACGTCACTGAATCAATCCTCTCCCA
TCTCCCAATCCCTTCCTTAGTCCGTTTCACTCTCGTCTCCAAACAATGGCGTTCCATAATCACCTCTCTTCCTCCTTCTC
CTTCTCCATCGTCATCATCACCACCATGGCTCTTCCTCTTCGGTATCCACAACACTTCCTCTTTCCACAACCAATCCTTC
GCTTTCGATCCTCTCTCCAACACTTGGCTCCGCCTCCCTCCTTCCTCTTCCTCATCCGATCATCTCGTCGGATCTAACCG
CTTCCTCTTCACCACCGCTCCTCGATTCTCCTTCTCACCGATCCTTAAACCTAATTGGCGATTCACTTCCCCTGTTCTGT
TTCCTCGAATCAATCCTCTCTTAAGCGTTTTCACAACTCTCTCTAACTCCTCTAAGCTAATCCTCGTTGGTGGATCTTCG
CGTATCGGCGGATTAGTCGATATCGAGGAACGGTTAGCTGTTCAGGTTTACGATCCTGTTCTTGATTCATGGGAGCTTTG
TTCACCACTTCCTGCTGATTTTAGATCTGGTCAAGATCATCAAACTTTAACTTCAGCTTTGTTTAAGAGAAGATTCTACG
TTTTCGATAACTATTCGTATTTTATCTCGTCGTTTTGCTTGGATTCTTATACATGGAGTGATGTTCAAACACTTAAACCA
CCTGGACTCTCGTTTGCGTTCTTGAATTCTTGTAATGGTATGCTTGTTCTTGGTGGAATGTGCGGGTTTTCGTTTAATCT
TTGGAGTATCGAAGAAGGTTCGATGGAATTTAGCGAAATCGCGGTTATGCCTGAGGGTTTGTTGTTTGGATTAGTTGATA
ATGAAGATGAGGAGGATAAGTTTAGGAGTTTGAAATGTGTTGGCTCTGGGAATCTTGTTTATGTGTTTAATGATGATTGT
CATAAGAAATTTCCAGCTTGTGTTTGTGAGATTGGTGGTGGTGAGAATGGGAAATGTAGTTGGAGAAGAGTTCCTTGTTT
GCCTTCTCCGGTTAATAAGTTTCATAAAGTTGTTAGTTTCTGCTCAACGGTATCTATTAGCGATGTTTTCCACCCCGAGG
ATGCTCATATTGGTGGTTGA