Details for Lyrate rockcress Locus 16057825

Position : sca3 ( 5`- 3069475 .. 3071049 -3` )
Annotation : [B2G] gtp cyclohydrolase i
External links : CoGe
PGDD synteny : 16057825

Protein [Map View]
MGALDEGHLNLDLDIGMKNGCIDLAFELQPETLAIQDAVKLLLQALHEDVNREGIKKTPFRVAKALREGTRGYKLKVKDY
VQSALFPEAGLDEGVGQAGGVGGLVVVRDLDHYSYCECCLLPFHVRCHIGYVPSGQRVLGLSKFSRVTDVFAKRLQDPQR
LADDICSALQHWVKPAGVAVVLECSHIHFPSLDLDSLHLSSHRGFAKLLVSSGSGVFEDESSNLWGEFRSFLMFKGVKTQ
ALCRNGSSVEEWCPSVKSSSKFSPEEDPEMVSAVVSILKSLGEDPLRKELIATPTRFLKWMLNFQRTNLEMKLNGVNSAK
VNGEVKEKRLHCELNMPFWSMCEHHLLPFYGVVHIGYFCAEGSNHNPIGSSLMKSIVHFYGFKLQVQERMTRQIAETLSP
LVGGDVIVVAEAGHTCMISRGIEKFGSSTATIAVLGRFSSDNSARAMFLDKIHTTNALKTDSGSPF*

DNA
ATGGGCGCTTTAGATGAGGGACATTTGAATCTGGACCTTGACATTGGAATGAAAAATGGCTGCATTGACCTTGCTTTCGA
GCTCCAACCTGAGACTTTAGCAATCCAAGACGCTGTCAAACTTCTCTTGCAAGCTCTTCATGAGGATGTCAATCGGGAAG
GCATCAAAAAGACTCCTTTCCGTGTCGCCAAGGCCCTTCGAGAAGGGACCAGAGGTTATAAGCTAAAGGTGAAGGACTAT
GTACAGAGTGCTCTGTTTCCAGAAGCAGGGTTGGATGAAGGAGTTGGGCAAGCAGGAGGAGTGGGAGGACTTGTCGTTGT
CAGAGATCTCGATCATTACTCTTACTGCGAATGTTGCTTGCTTCCTTTTCATGTGAGGTGTCACATAGGTTATGTCCCAT
CGGGCCAACGAGTGTTAGGACTGAGCAAGTTCTCTCGAGTCACTGATGTTTTCGCCAAGCGGCTCCAAGACCCTCAGCGT
TTGGCTGATGATATTTGTTCAGCTCTCCAACATTGGGTCAAACCGGCTGGAGTCGCTGTTGTTCTCGAATGCTCTCACAT
TCACTTCCCGAGTTTGGACTTGGACTCTCTGCACTTGTCGAGCCACCGTGGATTTGCGAAGCTACTGGTTTCCTCGGGCT
CAGGAGTTTTCGAGGATGAAAGCTCGAATCTTTGGGGTGAATTTCGGAGTTTCTTGATGTTCAAAGGTGTAAAAACGCAA
GCTTTGTGCAGAAATGGCAGCTCCGTGGAAGAGTGGTGCCCGAGCGTTAAAAGCTCGTCTAAATTCTCACCTGAAGAAGA
CCCGGAAATGGTTTCTGCTGTTGTTTCCATCCTGAAATCACTGGGAGAAGATCCGTTGAGGAAAGAACTCATTGCTACAC
CAACTCGATTCCTCAAATGGATGTTGAACTTCCAAAGAACCAACCTCGAGATGAAGCTAAACGGCGTTAACTCTGCCAAA
GTCAACGGCGAGGTCAAAGAGAAAAGGCTGCACTGTGAACTGAACATGCCCTTCTGGTCAATGTGTGAGCATCATTTGCT
TCCTTTCTATGGAGTTGTTCATATTGGCTACTTTTGTGCTGAAGGATCCAACCACAATCCTATTGGAAGTTCACTCATGA
AATCGATTGTACACTTTTATGGGTTCAAGCTTCAAGTGCAAGAGAGGATGACTCGACAGATCGCTGAGACGCTATCGCCT
CTTGTTGGCGGGGATGTGATTGTTGTGGCGGAAGCTGGGCATACTTGTATGATCTCTAGAGGAATTGAGAAGTTTGGAAG
CAGCACTGCAACAATCGCAGTTTTGGGTCGGTTTTCGAGTGACAATTCCGCAAGAGCCATGTTTCTAGACAAGATTCATA
CAACTAATGCCTTGAAGACAGATTCAGGCTCTCCATTTTGA