Details for Lyrate rockcress Locus 16057786

Position : sca3 ( 5`- 2481884 .. 2483191 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057786

Protein [Map View]
MDAIQLLWEAIMKATKKERRREDDDGEEASPESLVLPPEIITEILLRLPAKSIGRFRCVSKLFYSLSSDPGFAKNHLDLI
LRNDAVKSLHRKLIVSSHNLYSLDFNSIRDGIRDLAAVELNYPLKDDPSIFSEMIRNYVREHLYDDRRVMLKLNAKSYRR
NWVEIVGSSNGLVCISPGEGAVILYNPTTGDSKRLPETLRPKSVEYGRDNFQTYGFGFDDLTDDYKVVKLVATSDDILDA
SVYSLKADSWRRICNLNYEHNDGFYTSGVHFNGAIHWVFAEISHGQRVVVAFDIQTEEFREMPLPVEAEDCHHRFSNFVV
GSLNGRLCVVNSCYEVHDDIWVMSEYGEVKSWSRIRINLLYRSMKPLCSTKKDEEVLLELDGDMVLYNFETNASSNLGIR
GVKLSDGFEANTYVESLISPNSYGIVT*

DNA
ATGGATGCGATCCAGTTGCTGTGGGAAGCGATAATGAAAGCGACGAAGAAAGAAAGACGGAGAGAAGATGACGACGGCGA
AGAAGCTTCACCGGAATCACTCGTCCTTCCTCCAGAGATCATTACAGAAATTCTTCTCCGATTACCAGCCAAATCGATCG
GGCGATTCAGGTGCGTATCAAAGCTATTTTACTCTCTGTCTTCGGATCCAGGATTCGCGAAGAATCACCTCGATCTGATC
CTTCGAAACGACGCCGTAAAATCGCTCCACCGTAAGCTCATCGTGTCTTCACATAATCTATACTCTTTAGATTTCAATTC
AATCCGTGACGGAATTAGGGATTTAGCGGCTGTGGAACTCAATTATCCTCTTAAAGACGATCCAAGCATTTTCTCTGAGA
TGATTAGGAATTACGTGAGAGAGCATCTGTACGATGATCGTCGTGTGATGCTTAAGCTGAATGCGAAATCGTATCGAAGA
AACTGGGTTGAGATCGTTGGATCTTCCAATGGTTTAGTGTGTATCTCTCCTGGTGAAGGAGCTGTTATCTTGTATAATCC
AACCACCGGAGATTCCAAGAGATTACCTGAAACTTTGCGTCCCAAATCTGTAGAATACGGAAGAGATAATTTCCAAACTT
ATGGATTTGGTTTCGATGATCTCACTGATGATTACAAAGTGGTGAAGCTTGTTGCTACCAGTGACGATATTCTCGATGCT
AGTGTCTATTCCTTGAAGGCAGACTCATGGAGACGGATCTGCAATTTGAATTATGAACACAACGATGGCTTCTACACGTC
CGGTGTACATTTCAACGGTGCGATTCACTGGGTTTTCGCAGAGATTAGCCACGGCCAAAGAGTGGTCGTAGCATTTGATA
TTCAAACCGAGGAGTTTCGAGAGATGCCATTGCCTGTTGAAGCTGAAGATTGTCACCATAGGTTTAGCAACTTTGTGGTC
GGAAGTCTCAATGGACGTCTCTGTGTGGTCAATAGTTGCTACGAGGTGCACGATGATATATGGGTGATGAGTGAGTACGG
TGAAGTTAAATCATGGAGCCGAATTCGGATCAACTTGTTGTATAGGTCGATGAAACCGCTTTGTTCGACTAAGAAGGATG
AAGAGGTTCTTCTAGAGCTTGATGGAGACATGGTGTTGTACAACTTTGAAACCAATGCATCGAGTAATCTGGGAATTCGC
GGGGTTAAGCTTAGTGACGGATTCGAGGCAAATACATACGTAGAGAGCCTCATATCACCCAACTCTTATGGTATAGTGAC
CTGA