Details for Lyrate rockcress Locus 16057774

Position : sca3 ( 5`- 5370845 .. 5370372 -3` )
Annotation : [B2G] dnaj heat shock n-terminal domain-containing protein
External links : CoGe
PGDD synteny : 16057774

Protein [Map View]
MAGTLVYSAGRFSPGNCLLPQPKTARFYSGTARFPTGVSSFKASAQTLNAEPAVTESVRRRVSSLYELLKVNETASLTEI
KTAYRSLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYDSTLRAPRRRVHAGAMGRSGRVYTTTRRWETDQCW*

DNA
ATGGCCGGAACCCTAGTTTACTCCGCCGGGAGATTCTCACCGGGAAATTGTCTTCTCCCCCAACCGAAAACGGCCAGATT
CTACAGCGGAACCGCGAGATTTCCCACAGGAGTTTCGTCGTTTAAGGCTTCAGCTCAGACGCTAAACGCCGAGCCAGCTG
TAACGGAATCCGTTCGTCGGAGAGTTTCTAGCCTCTACGAATTACTGAAAGTGAATGAAACGGCGTCGTTGACGGAGATC
AAGACGGCCTACCGGAGCTTAGCTAAAGTATATCATCCAGATGCGTCGGAATCGGACGGTCGAGATTTCATGGAGATTCA
CAAAGCTTACGCGACACTGGCGGATCCGACTACAAGAGCGATCTACGACTCGACGCTTAGAGCACCTCGGAGACGGGTAC
ACGCTGGAGCGATGGGTCGGTCGGGTCGGGTTTACACGACGACCCGGAGATGGGAGACGGATCAGTGTTGGTAA