Details for Lyrate rockcress Locus 16057773

Position : sca3 ( 5`- 6636957 .. 6638116 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897878 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057773

Protein [Map View]
MGGEDEVVSVELPAPSSWKKLFYPNKVGSVKKTEIVFVAPTGEEISNRKQLEQYLKSHPGNPAIAEFDWTTSGTPRRSAR
ISEKTKATPSPDKEPPKKRGRTKSSGSKKDAEGEKSEGAEENSHVKDTEMNPPEGNVDNENGSGETGKVNDAKDNMVAKE
TPSATPVQEAGDRESVKEKASDSVEDSSKERVESQTDKEKEIGSIEKNSVDTEKKTVEASDEQKNSEAETRNHEENGLTT
EAEGKEKTAEAEATE*

DNA
ATGGGTGGTGAAGATGAAGTTGTATCTGTTGAGCTACCAGCACCTTCTTCATGGAAGAAATTGTTTTACCCGAACAAAGT
GGGTTCAGTGAAGAAAACAGAGATTGTGTTTGTTGCTCCAACGGGTGAGGAGATCAGTAACAGAAAGCAGCTGGAGCAGT
ATCTCAAATCGCACCCTGGAAACCCCGCGATAGCTGAGTTTGATTGGACGACTAGTGGGACACCTAGGAGATCTGCAAGA
ATCAGCGAGAAGACTAAGGCTACGCCGTCACCAGATAAAGAGCCACCCAAGAAGCGAGGTAGAACCAAATCTTCAGGGTC
AAAGAAAGATGCAGAAGGTGAGAAATCAGAGGGAGCAGAGGAAAACTCTCATGTGAAAGATACTGAAATGAATCCTCCAG
AGGGAAACGTCGATAATGAGAATGGCTCTGGTGAAACTGGGAAGGTGAATGATGCAAAAGACAACATGGTTGCAAAGGAA
ACTCCAAGTGCGACTCCAGTTCAAGAAGCGGGTGACCGTGAGTCGGTGAAGGAGAAAGCCTCGGATTCAGTTGAAGATAG
TAGTAAGGAGAGAGTGGAGTCTCAGACTGACAAAGAAAAAGAGATTGGCTCAATTGAAAAGAACTCGGTAGATACAGAGA
AAAAGACTGTTGAAGCTAGTGATGAGCAGAAGAATTCTGAAGCTGAGACCAGAAACCATGAGGAAAATGGTCTGACAACA
GAAGCTGAGGGGAAAGAGAAAACCGCAGAAGCAGAAGCTACCGAATAG