Details for Lyrate rockcress Locus 16057749

Position : sca3 ( 5`- 1952069 .. 1950451 -3` )
Annotation : [B2G] integral membrane yip1 family protein
External links : CoGe
PGDD synteny : 16057749

Protein [Map View]
MMSGGNYTTIDSQKVSGSVPSVPDPGHTTVKFTESNLQTFPPSATQGKISGGSNPPRDADDTFSGHGNGSTDEPQSGGWL
HKFTVGAYKPFFDVDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWKKQEWNYD
INLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPALVPNLSVVPVEIFRWVIAGVAGFMSATF
VALNLKAHINSAGERSILIIASIFLLQLALAVVLKLYIFNVKV*

DNA
ATGATGTCCGGCGGGAACTACACGACTATCGACAGCCAGAAAGTCTCTGGATCTGTACCTTCTGTTCCAGATCCAGGCCA
TACCACCGTCAAATTCACAGAATCAAATCTACAAACTTTTCCTCCATCTGCTACTCAGGGCAAGATCTCTGGTGGTAGTA
ATCCCCCTCGAGATGCTGACGATACATTTTCTGGGCATGGTAATGGTAGTACAGATGAACCTCAGTCTGGTGGCTGGCTT
CATAAATTCACTGTTGGTGCTTACAAGCCCTTCTTTGATGTTGACACTTCGGATGTTGTAGAGCGACTCAAGGAATCTCT
TTTCCCATTCCGTGGAACATTTACAGAGAAGACAGCTGATAAACCTGACTTGTATGGCCCATTCTGGATCTGCACCACCT
TGATATTCGTTGCAGCATCTATCGGCACATTTGTCACATACATAGCACACAAATGGAAGAAACAAGAATGGAACTACGAT
ATCAATCTAGTGACTTGGTCTGCAGGAGTGTTCTACGGATATGTCACAATTGTTCCTCTAGCATTATATGTCGTTCTCAA
ATACTTCTCTGCACCATCAGGCCTCGTCCAGCTCTTCTGTCTCTATGGCTATTCCCTTTTCGTCTTTATCCCAGCATTGG
TACCAAATCTCTCGGTTGTCCCAGTGGAGATTTTCAGATGGGTGATCGCGGGTGTAGCCGGGTTCATGTCTGCAACATTT
GTGGCTTTGAACCTGAAAGCTCATATCAATTCCGCTGGAGAGAGATCGATCCTGATTATCGCCAGCATCTTTCTTTTGCA
GCTCGCGCTTGCGGTCGTGCTGAAGCTCTACATCTTCAATGTCAAAGTTTGA