Details for Lyrate rockcress Locus 16057741

Position : sca3 ( 5`- 1237898 .. 1241027 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057741

Protein [Map View]
MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSAAGIKYIPSNTFSHYDQVLDTTAMLGAVPP
RYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYIVPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVS
YLLLSKLAKGVDKSFDLLSLLPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGQKLQAFSGAYAELESTLSGLNVLV
ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKAGFPQGKYLFAGVVDGRNIWANDLAASLITLQSLEGVVGKD
KLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVEVDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQK
AAAALKGSDHRRTTEVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED
LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTVFWSSTAQSMTKRPMKGMLTG
PVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIGVIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQD
STQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLGSAK*

DNA
ATGGCTTCCCACATTGTTGGATATCCACGTATGGGACCTAAGAGAGAGCTCAAGTTTGCATTGGAGTCTTTCTGGGATGG
CAAGAGCACTGCCGAGGATTTGCAGAAGGTGTCTGCTGATCTCAGGTCTGATATCTGGAAACAGATGTCTGCTGCTGGGA
TTAAGTATATCCCAAGCAACACCTTTTCTCATTATGACCAGGTGCTTGACACCACAGCCATGCTTGGTGCTGTTCCACCT
AGATATGGATTTACCAGTGGTGAGATTGGTCTCGATGTTTACTTCTCTATGGCTAGAGGAAATGCCTCTGTTCCAGCTAT
GGAGATGACCAAGTGGTTTGACACCAACTACCATTACATCGTCCCAGAGTTGGGCCCTGAAGTGAAGTTCTCTTACGCAT
CTCACAAGGCTGTGAATGAGTATAAGGAGGCCAAGGCTCTTGGTGTTGAGACCGTCCCTGTACTTGTTGGCCCTGTCTCT
TACTTGCTTCTTTCCAAGCTTGCTAAGGGTGTTGACAAGTCATTTGATCTTCTCTCCCTTCTCCCCAAAATTCTCCCAGT
CTACAAGGAAGTCATTGCAGAGCTCAAGGCAGCTGGTGCCTCATGGATTCAGCTTGATGAGCCTCTCTTTGTCATGGATC
TTGAGGGTCAAAAACTCCAGGCTTTTAGCGGTGCCTATGCTGAGCTTGAATCAACTCTCTCTGGTCTGAATGTTCTTGTG
GAGACCTACTTTGCTGATATCCCTGCTGAAGCATACAAGACTCTTACTTCCTTGAAGGGTGTGACTGCCTTTGGATTTGA
TTTGGTTCGTGGTACCAAGACCATTGACTTGATCAAGGCTGGTTTCCCCCAGGGCAAGTACCTCTTTGCTGGTGTTGTTG
ACGGAAGAAACATCTGGGCCAATGACCTCGCTGCCTCTCTCATCACCTTGCAGTCACTTGAGGGTGTTGTTGGTAAAGAC
AAGCTTGTGGTCTCAACCTCTTGCTCTCTTCTCCACACTGCCGTTGACCTTGTTAACGAGACTAAGCTTGATGCTGAAAT
CAAGTCGTGGCTAGCTTTTGCCGCCCAGAAGGTTGTTGAAGTTGACGCATTGGCCAAGGCTTTAGCCGGTCAGACGAATG
AGAGTTTCTTCACTGCCAACGCTGATGCTTTGTCTTCGAGGAGGTCTTCCCCAAGAGTCACCAATGAGTCTGTCCAGAAG
GCTGCTGCTGCTTTGAAGGGGTCTGACCACCGCCGTACAACCGAAGTTAGCGCAAGGCTAGATGCTCAGCAGAAGAAGCT
TAACCTTCCAATCCTCCCAACCACCACCATTGGATCCTTCCCACAGACCGTGGAACTCAGGAGAGTTCGCCGTGAATACA
AGGCGAAGAAAATCTCTGAAGAGGATTACGTCAAGGCCATCAAGGAAGAGATCAAGAAAGTTGTTGACATCCAAGAGGAC
CTTGACATTGATGTTCTTGTTCACGGAGAGCCTGAGAGAAACGATATGGTTGAGTACTTTGGAGAGCAATTGTCAGGTTT
CGCATTCACAGCAAACGGGTGGGTGCAATCCTATGGATCTCGCTGTGTGAAGCCACCAGTTATCTACGGTGACGTGAGCC
GCCCCAAGCCAATGACAGTCTTCTGGTCCTCAACAGCCCAGAGCATGACCAAACGTCCAATGAAGGGTATGCTTACAGGT
CCAGTCACAATTCTCAATTGGTCTTTTGTCAGAAACGACCAGCCCAGGCACGAAACCTGTTACCAGATCGCTTTGGCCAT
CAAAGACGAAGTGGAAGACCTTGAGAAAGGCGGTATTGGAGTCATTCAGATCGATGAAGCCGCACTCAGAGAAGGATTGC
CTCTTAGGAAAGCCGAACACTCTTTCTACTTGGACTGGGCTGTTCACTCTTTCAGAATCACCAACTGTGGCGTCCAAGAC
AGCACTCAGATTCACACTCACATGTGTTACTCAAACTTCAATGACATCATCCACTCAATCATCGACATGGACGCTGATGT
CATCACCATTGAGAACTCTCGTTCAGACGAGAAGCTTCTATCAGTGTTCCGTGAAGGAGTGAAGTACGGTGCAGGAATCG
GTCCTGGTGTTTACGACATTCACTCTCCAAGAATACCATCCACAGAAGAAATTGCAGACAGGATCAACAAGATGCTTGCG
GTTCTTGAGCAGAACATCTTGTGGGTTAACCCTGACTGTGGTCTGAAGACAAGGAAGTACACTGAGGTTAAACCAGCACT
TAAAGCCATGGTTGACGCGGCTAAGCTTATCCGCTCCCAGCTCGGTAGTGCCAAGTGA