Details for Lyrate rockcress Locus 16057734

Position : sca3 ( 5`- 5016171 .. 5015422 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478610 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057734

Protein [Map View]
MSKQRTRLRTVPEKSPVEKKRYSSRLLQQILEIIRYFKQQKGFGDIPRNLCLYSTRYGRALKSSQEGIYMKILPLMLIAF
VILLSAPIKVVGTKLPSYCCGRLVKPQPCACKYFIKNPVLLPRLLIACRVPHPKC*

DNA
ATGTCAAAGCAAAGAACACGTTTAAGAACTGTACCTGAGAAATCGCCTGTAGAGAAGAAGAGATATAGCTCGAGACTTCT
TCAGCAGATTCTGGAGATCATAAGATATTTTAAGCAGCAAAAGGGCTTTGGAGATATTCCAAGAAATCTCTGTTTGTATT
CCACGCGCTATGGTCGCGCGTTGAAGTCGTCGCAAGAGGGGATTTACATGAAGATCCTTCCATTGATGCTCATTGCCTTC
GTCATACTCTTGTCTGCTCCGATCAAAGTTGTTGGAACCAAACTGCCGAGTTACTGTTGTGGAAGACTGGTAAAGCCACA
ACCATGTGCTTGTAAGTATTTTATTAAGAACCCTGTCCTCTTGCCCAGACTTCTCATTGCTTGTCGTGTTCCTCATCCTA
AGTGTTAA