Details for Lyrate rockcress Locus 16057730

Position : sca3 ( 5`- 475407 .. 476483 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057730

Protein [Map View]
MNIVSWKDANDEVSGGTTRRREGEVEEDQEEAQVRATSGKTVIKKPPTSISSSSSSSSWMKSKDPRIVRVSRAFGGKDRH
SKVCTLRGLRDRRVRLSVPTAIQLYDLQERLGVDQPSKAVDWLLDAAKEEIDELPPLPISPENFSIFNHHHSFLNLGQRP
GQDPTQLGFKINGCVEESTTTSREANNKEKGENDVVFTNNHHVGSYGTYHNMEHHHHHHQHLSLQADYHNHQHQLHSLVP
FPSQILVCPMTTSTTATIQSLFPSSPSAGSGTMETLDLRQMVSHFQMPLMGNSSSSSSQNISTLYSLLHGSNSNNGGRDI
NNRMSSVQFNRANSTTTANMSRHLGSESSTSRGSDHHM*

DNA
ATGAATATCGTCTCTTGGAAAGATGCAAACGACGAAGTTTCAGGCGGCACTACCAGAAGACGTGAAGGAGAAGTAGAAGA
AGATCAAGAAGAAGCCCAAGTCAGAGCCACCAGTGGCAAAACCGTAATTAAAAAGCCACCAACCTCGATCTCTTCTTCTT
CTTCTTCTTCGTCGTGGATGAAATCGAAGGATCCGAGGATTGTTAGGGTTTCACGCGCCTTTGGAGGCAAAGACCGTCAC
AGCAAAGTGTGTACGTTACGTGGGTTACGTGACAGACGCGTGAGATTATCAGTCCCAACGGCTATTCAGCTCTACGATCT
TCAAGAACGGCTCGGTGTTGACCAGCCTAGCAAAGCCGTTGACTGGTTGCTTGATGCAGCTAAAGAGGAGATCGACGAGC
TCCCTCCGTTACCTATCTCGCCGGAAAATTTCAGCATCTTCAACCATCATCACTCCTTCTTGAATCTTGGTCAAAGGCCG
GGTCAAGATCCGACCCAACTCGGGTTTAAAATCAATGGATGTGTAGAAGAGTCTACTACTACTAGCCGTGAAGCAAACAA
TAAAGAGAAAGGAGAAAACGATGTCGTTTTCACAAACAATCATCATGTTGGGTCTTATGGAACTTATCACAACATGGAAC
ACCATCATCATCATCACCAACATTTGAGTTTACAGGCGGATTATCATAATCATCAACATCAACTACATAGTCTTGTCCCA
TTTCCATCACAAATTTTGGTATGTCCAATGACGACATCAACAACAGCAACTATACAATCTTTGTTTCCATCATCGCCGTC
AGCTGGTTCAGGAACTATGGAGACATTAGATCTGAGGCAAATGGTGAGCCATTTTCAAATGCCATTAATGGGTAATTCTT
CATCTTCGTCATCCCAAAACATTTCCACATTATATTCATTGTTACATGGTAGTAATAGCAACAATGGTGGTAGAGACATC
AATAATCGGATGTCGTCGGTCCAATTCAACCGAGCTAATAGCACTACAACGGCTAATATGTCGAGGCATCTAGGCTCGGA
GAGTAGTACAAGTAGAGGAAGTGATCACCATATGTGA