Details for Lyrate rockcress Locus 16057641

Position : sca3 ( 5`- 605649 .. 603501 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896213 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057641

Protein [Map View]
MATFNVLCSNRFLFKGGYSPDKSIRKLSSRSCELNVCVARTRRNQSFSCRRLGGFLEFGDTRLGVRNGFVCNSEIKRLVS
GDYGDKETRIGENGRNKGKRRRFSLRLRPRLRLVRMRLGRFDFRASMEDFRYFLKRNIKRVILSTGVALIFGLCYLFLRL
TAVPSPSIVPYSDFVTNLRGGSVSKVLLEEGSRRIYYNTDENVEVVDDVHKSETLEDPAIQIDGGTVREAVTKDGTPRKV
RALTPVWKYVTRKVDHDEKFLLSLMREKGITYSSAPQSALMSMRTTLITIISLWIPLTPLMWLLYRQLSASNSPAKKRRS
KNPTVGFDDVEGVDSAKDELVEIVSCLQGSINYKKLGARLPRGVLLVGPPGTGKTLLARAVAGEAGVPFFSVSASEFVEL
FVGRGAARIRDLFNAARKNSPSIIFIDELDAVGGKRGRSFNDERDQTLNQLLTEMDGFESDTKVIVIAATNRPEALDSAL
CRPGRFSRKVVVAEPDQEGRRKILAVHLRDVPLEEDAFLICDLVASLTPGFVGADLANIVNEAALLAARRGGEAVAREDI
MEAIERAKFGINDKEVRPRTLGNELSKLFPWMPSLARRNGPDQDGLQGPLGYQTLS*

DNA
ATGGCTACTTTCAATGTTCTTTGTAGCAATCGGTTTCTATTCAAAGGTGGTTATTCTCCGGATAAATCTATTAGAAAGTT
GTCTTCGAGGAGTTGTGAGCTTAATGTTTGTGTAGCTAGAACCAGGAGGAATCAATCGTTTAGTTGCAGGAGACTTGGTG
GGTTTCTGGAATTTGGTGATACCAGATTAGGGGTTAGAAATGGGTTTGTTTGTAATAGCGAGATTAAGCGACTTGTGAGT
GGTGATTACGGAGATAAAGAGACTCGTATTGGTGAAAATGGTAGAAACAAAGGGAAGAGAAGAAGGTTTTCTCTTAGGCT
TCGACCTAGATTACGATTAGTGAGAATGAGACTTGGGAGATTTGATTTCAGAGCATCAATGGAAGATTTTCGATATTTTT
TGAAAAGGAATATCAAAAGAGTGATCTTGTCCACCGGTGTGGCTTTAATCTTTGGACTGTGTTATTTGTTCTTGAGGTTA
ACTGCTGTTCCGTCCCCATCCATTGTTCCTTATTCAGATTTCGTAACGAATCTTCGAGGTGGTTCTGTTTCAAAGGTTTT
GCTCGAAGAAGGCTCTCGTCGAATCTATTACAACACTGATGAGAATGTTGAGGTTGTTGATGATGTTCACAAGTCTGAAA
CTTTAGAAGATCCGGCAATCCAAATTGATGGCGGCACAGTGAGGGAAGCTGTTACGAAAGACGGTACTCCGCGAAAGGTT
CGAGCTTTGACTCCTGTGTGGAAGTATGTGACAAGAAAAGTCGATCATGATGAGAAGTTTCTTCTTAGCTTAATGAGAGA
GAAAGGCATTACTTATAGTTCGGCTCCTCAATCTGCATTGATGTCAATGAGAACTACTTTGATAACAATCATCTCTCTGT
GGATTCCTTTGACACCTCTTATGTGGCTTCTTTATCGGCAACTCTCAGCATCTAACAGCCCTGCGAAGAAACGACGGTCT
AAAAATCCCACTGTTGGCTTCGATGATGTTGAGGGTGTTGATTCTGCTAAAGACGAGCTCGTGGAGATAGTCTCATGTCT
TCAAGGAAGTATAAACTACAAAAAACTAGGAGCAAGATTACCGAGAGGTGTGCTTTTGGTCGGTCCACCAGGGACCGGTA
AAACCTTGTTGGCTCGGGCTGTAGCTGGAGAAGCGGGAGTTCCATTTTTCTCTGTCTCCGCTAGTGAGTTCGTTGAATTG
TTTGTTGGAAGAGGCGCAGCGCGAATCAGAGATCTTTTCAATGCAGCCAGGAAAAACTCACCTTCCATTATATTCATTGA
TGAGCTTGATGCGGTTGGAGGAAAACGTGGTAGGAGTTTCAATGATGAACGTGACCAGACGCTAAACCAGTTGCTTACTG
AGATGGATGGATTCGAGTCAGACACGAAAGTTATTGTAATTGCAGCAACTAACCGACCAGAAGCGTTAGACTCAGCTCTT
TGTCGGCCTGGAAGGTTCTCTAGAAAAGTTGTGGTTGCAGAACCAGACCAAGAAGGCCGTCGGAAAATCTTGGCCGTACA
TTTGAGAGACGTCCCTCTAGAAGAAGATGCATTTCTCATATGTGATCTGGTTGCTTCTTTAACTCCCGGATTCGTAGGTG
CTGATCTCGCCAACATTGTCAATGAAGCTGCATTGCTAGCTGCTCGAAGAGGAGGAGAAGCGGTGGCACGGGAAGATATA
ATGGAAGCGATAGAGAGGGCGAAATTCGGGATCAATGATAAGGAAGTGAGGCCAAGGACATTAGGAAATGAGCTAAGCAA
GCTGTTCCCATGGATGCCATCTTTAGCTAGAAGGAACGGACCAGATCAAGACGGTTTACAAGGACCGTTAGGCTATCAAA
CTCTCAGCTAA