Details for Lyrate rockcress Locus 16057616

Position : sca3 ( 5`- 4945926 .. 4944809 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057616

Protein [Map View]
MAAPFTLRKIGVPPNSANLTEARRRVFDFFRAACRSIPTIMDIYNLQDVVAPSQLRYAISAQIRNNAHITDPKVIDLLIF
KGMEELTDIVDHAKQRHHIIGQYVVGEGLVQNTGNKDQGKTDFLKNFYTSNYF*

DNA
ATGGCGGCACCATTCACGTTGAGGAAAATCGGTGTTCCACCGAACTCGGCGAACCTAACGGAAGCTCGCCGCCGTGTATT
CGATTTCTTTAGAGCTGCCTGTAGATCTATCCCCACCATCATGGACATTTACAATCTTCAAGATGTCGTCGCGCCTTCTC
AGCTCCGCTATGCAATCTCTGCTCAGATTCGGAATAACGCTCACATCACCGACCCTAAGGTAATTGATCTTCTTATATTC
AAGGGAATGGAAGAGCTGACTGACATAGTGGATCACGCAAAGCAGCGTCACCACATCATTGGTCAATACGTGGTGGGTGA
AGGGCTCGTTCAGAATACTGGAAACAAGGATCAAGGAAAGACTGATTTTCTCAAGAATTTCTACACCAGCAACTACTTTT
GA