Details for Lyrate rockcress Locus 16057594

Position : sca2 ( 5`- 16591701 .. 16596546 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_895388 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057594

Protein [Map View]
MSEWLISTNPTFSTAFPSSCFTVVKPNFILLSSEFDSYTPQCLFNSLTTTMRLSKRQLSLPFSLCVSTFSPRFRFHHFPG
KFPAPRREFLHTTGTSQLCFKSSMEDQKPTALSENALQFHTVGSRDGCEVPHKWSSPEGGKKIDISNQIFCNRSLNMKNI
IAVGFDMDYTLAQYKSETFESLAYEGTVRKLVYDLGYPNELLEWTFDWNYMVRGLVLDKKRGNILKMDRHKYVKVAYHGF
RELSKEDKVDIYGSSLVRDSFDEPDYALIDTLFSLAEAYLFAQLVDFKDNNPEKVPKDVDYARMYKDVRAAVDLCHRDGT
LKQMVAKEPNRYINEDTTIVPLIKMIRDSGRSTFLVTNSLWDYTNIVMNFLCGGRTVHGPHTCNFDWLQYFDVVITGSAK
PGFFHEESRANLFEVEPQSGMLINTDNGTPMAQVGDPSPKFLLKSKDKGCRVFQGGNVGHLHSLLSIESSSQVLYVGDHI
YGDILRSKKVLGWRTMLVVPELEKEVELLWELRNMRKELILMRNERDSVEDKIHHLNWSLKFEDINENDKQEMLSALKDL
ESKRDQVRLSHQQAQRECHQKFHKVWGQLMKTGYQGSRFAHQVERFACLYTSQVSNLRLYSPDKYYRPSEDFMSHEFHLL
PL*

DNA
ATGTCTGAGTGGTTAATCAGTACGAATCCTACTTTTTCGACGGCATTCCCAAGTAGTTGTTTTACAGTTGTAAAACCCAA
TTTTATTCTCCTTTCTTCAGAATTCGATTCGTATACTCCTCAATGCCTATTTAATAGCTTAACCACCACCATGCGTCTCT
CTAAACGCCAACTTTCTCTTCCTTTTTCTCTCTGTGTCTCTACTTTCTCTCCTCGTTTCCGTTTCCATCATTTTCCCGGA
AAATTTCCAGCTCCTCGTAGAGAGTTTCTCCACACCACTGGGACAAGCCAGCTGTGTTTTAAGAGTTCGATGGAAGATCA
GAAACCGACTGCTCTCAGTGAAAATGCGTTGCAGTTTCACACTGTGGGCTCCAGGGATGGATGTGAAGTTCCTCATAAAT
GGTCCTCCCCGGAAGGAGGAAAGAAAATTGATATAAGCAATCAGATTTTCTGCAATAGATCGTTGAATATGAAAAATATC
ATTGCCGTAGGCTTTGATATGGACTACACTCTTGCTCAATACAAGTCCGAAACTTTCGAGTCCCTTGCTTATGAAGGAAC
TGTCAGGAAATTGGTTTATGATTTGGGGTATCCAAATGAGCTGCTAGAGTGGACATTTGATTGGAATTACATGGTTAGAG
GCTTGGTGCTTGACAAAAAGAGGGGAAACATCTTAAAGATGGACCGCCATAAATATGTGAAAGTAGCTTACCATGGGTTT
AGGGAGCTTTCTAAGGAAGACAAAGTTGACATCTACGGAAGCAGCCTAGTACGAGATTCTTTTGATGAACCTGACTACGC
TCTCATAGATACTCTCTTTTCACTGGCCGAAGCCTATTTGTTCGCTCAACTCGTTGATTTTAAAGATAATAACCCAGAAA
AGGTTCCCAAGGACGTTGATTATGCTCGGATGTACAAAGATGTTCGTGCTGCTGTTGATTTGTGCCACCGCGACGGAACT
TTAAAGCAGATGGTGGCAAAAGAACCTAATAGGTATATCAATGAGGATACCACGATAGTACCCCTCATTAAAATGATCAG
AGATTCTGGACGTTCTACATTCTTGGTGACCAATAGTTTGTGGGACTACACAAATATTGTAATGAACTTTCTGTGTGGAG
GGCGCACGGTACATGGTCCGCATACTTGCAACTTTGATTGGCTCCAGTATTTTGATGTTGTGATCACTGGCAGTGCAAAA
CCTGGTTTCTTCCATGAAGAGAGCCGTGCTAACCTTTTTGAGGTGGAACCTCAGTCTGGAATGCTTATTAATACTGACAA
TGGAACACCTATGGCTCAGGTGGGAGATCCTTCACCAAAATTTTTACTGAAGAGTAAAGATAAAGGTTGTCGAGTTTTTC
AAGGTGGAAATGTCGGGCATCTTCACAGTTTGCTCTCAATTGAGTCAAGTTCACAGGTACTTTATGTTGGTGATCATATA
TACGGTGATATCTTGCGCAGCAAAAAAGTACTTGGCTGGAGAACTATGCTTGTAGTTCCAGAATTAGAAAAAGAGGTTGA
ACTTTTATGGGAACTGAGGAATATGCGTAAGGAACTTATTTTGATGAGAAACGAGCGTGATTCAGTTGAAGACAAAATTC
ACCACTTGAATTGGTCCCTAAAGTTTGAGGATATCAACGAGAATGATAAGCAGGAAATGTTATCAGCGCTCAAGGACTTA
GAGTCTAAAAGAGATCAAGTACGACTGAGTCATCAACAAGCTCAAAGAGAATGTCACCAAAAGTTTCACAAGGTCTGGGG
GCAACTGATGAAAACAGGCTACCAGGGTTCTCGATTTGCTCACCAGGTAGAGAGATTTGCATGCCTGTACACAAGCCAAG
TCTCAAACCTACGCTTGTACTCACCAGACAAGTATTACAGACCCAGTGAAGACTTCATGTCCCATGAATTTCACCTTCTT
CCTCTGTGA