Details for Lyrate rockcress Locus 16057587

Position : sca3 ( 5`- 5447074 .. 5448235 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057587

Protein [Map View]
MLCVSLRNRIHNWLRDYVRLQSVVVILIYAQIGCALIGSLGALYNGVLLINLAIALFGLVAIESNSQSLGRTYAVLLFCA
ILLDVSWFILFSNEIWNISSEMYQVFYIFSVKLTLAMEIAGFVVRLSSSLLWFQIYRLGASIIDSSFPRQPDSDLRNSFL
EPPLLARQRSRDPELRNSFLQPPAIAKQRSRSDEILEDSIDQPASYTPLFDGGQSNITSPNAKQVFLCSTYSSLKLFMCS
L*

DNA
ATGCTTTGTGTTTCTTTACGAAATAGAATTCACAATTGGCTTCGCGACTACGTTAGGCTCCAATCTGTCGTCGTGATTCT
TATCTACGCTCAGATAGGGTGCGCGTTGATCGGTTCACTAGGGGCATTGTACAATGGAGTCTTGCTGATAAATTTGGCGA
TTGCGTTATTTGGGTTAGTGGCAATCGAGAGTAATAGCCAGAGTCTAGGCAGAACCTATGCGGTTCTTCTTTTCTGCGCC
ATTCTTCTTGATGTCTCATGGTTCATACTCTTCTCCAACGAGATTTGGAACATTTCTTCTGAGATGTATCAAGTCTTTTA
CATCTTCTCTGTGAAACTCACCCTGGCTATGGAAATTGCTGGGTTCGTTGTGAGGCTATCGTCCTCTCTGTTATGGTTTC
AGATCTATAGGCTGGGAGCTTCTATTATAGACTCTTCGTTTCCCCGTCAACCTGATTCAGATTTACGAAATAGCTTCTTA
GAACCTCCTCTTTTAGCTAGGCAACGTTCACGTGATCCAGAATTACGGAATAGCTTCTTACAGCCTCCTGCTATAGCTAA
GCAACGTTCGCGTTCTGATGAAATCTTGGAAGATTCTATTGACCAACCGGCCTCCTACACTCCTCTGTTTGATGGCGGCC
AAAGCAATATCACTTCGCCCAATGCAAAACAGGTCTTTTTATGTTCTACCTATTCTTCTCTTAAGTTGTTTATGTGCTCA
TTGTAG