Details for Lyrate rockcress Locus 16057538

Position : sca3 ( 5`- 3596215 .. 3585878 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057538

Protein [Map View]
MNPATDPVSAAAAALAPPPQPPQPHRLSTSCDRHPEERFTGFCPSCLCERLSVLDQSNNGGASSSSSSKKPPTISAAALK
ALFKPSGNNGGGGGNNNGNGRVKPGFFPELRRTKSFSASKNNEGFSGVFEPQRRSCDVRLRSSLWNLFSQDEQRNLPSNV
SGGEIEVEPRKSSVAEPVLEVNDEGEAESDDEVEEEEEGFLNWMWKEGFKPDVFSYSTVINDLAKTGKLDDALELFDDMS
ERRVAPDVTCYNILIDGFLKEKDHKMAMQLWDKLLEDSSVYPNVKTHNIMISGLSKCGRVDDCLKIWDRMKQNEREKDLY
TYSSLIHGLCDEGNVDKAESVFNELVERKAFIDVVTYNTMLGGFCRCGKIKESLELWRIMEQRNSVNIVSYNILIKGLLE
NGKIDEATMIWRLMPAKGYAADNTTYGIFIHGLCVNGYVNKALGVMQEVESKEEEENYVEAGDFEILNDSGELIGEKSDE
IVEVREEIEEAEKPEKGLSEEELKPIKDHIDLDTQTKKPSVRRSFWSAASVFSKKLQKWRQNQKMKKRRNGGDHRPGSAR
LPVEKPIGRQLRDTQSEIADYGFGRRSCDTDPRFSLDAGRFSLDAGRFSVDIGRISLDDPRYSFDEPRASWDGSLIGRTA
FPPAVRAPPPPSMLSVVEDAPPPLHRHVTRADMQFPVEEPAPPPPVVNQSNGVSDPVILPGGSIQTRDYYTDSSSRRRKS
LDRSSSMRKTAAAVVADMDEPKLSVSSAISIDAYSGSLRDNNYAAETTDNGFFREPAVMIGERKVNSNDSNKKSRRWGKW
SILGLIYRKSVNKYEEEEEEEDRYRRLNGGMVERSLSESWPELRNCGGVGGGPRMVRSNSNVSWRSSGGGSARKVNGLDR
RNKSSRYSPKNGENGMLKFYLPHMKGSRRMSSAGGGGGGGGGGGGWANSHGHSIARSVMRLY*

DNA
ATGAATCCAGCTACAGACCCAGTCTCCGCCGCCGCAGCTGCTCTAGCTCCGCCTCCTCAACCTCCGCAGCCTCACCGTCT
CTCTACCTCTTGCGACCGTCACCCAGAAGAGCGGTTCACCGGTTTTTGCCCTTCTTGTCTCTGTGAACGTCTCTCAGTCT
TAGATCAGAGCAACAATGGCGGTGCCTCTTCTTCTTCTTCCTCTAAAAAACCTCCGACCATCTCTGCTGCGGCTCTCAAG
GCTCTCTTTAAGCCTTCTGGAAACAACGGAGGAGGCGGTGGAAACAACAACGGAAACGGCCGGGTTAAACCCGGATTCTT
CCCGGAGCTTCGTCGGACGAAATCTTTCTCTGCGTCTAAGAACAACGAAGGATTCTCCGGCGTGTTTGAGCCACAACGTA
GGTCTTGTGACGTCAGACTTCGAAGCTCTCTGTGGAACTTGTTTAGCCAAGATGAGCAACGAAACCTTCCAAGCAATGTC
TCCGGCGGTGAGATTGAGGTCGAGCCGAGGAAATCTAGCGTTGCGGAGCCTGTTTTAGAGGTTAACGATGAAGGAGAAGC
TGAAAGTGACGACGAAGTTGAAGAGGAGGAGGAAGGGTTTCTTAATTGGATGTGGAAAGAGGGTTTTAAGCCGGATGTGT
TTAGTTACAGCACTGTGATCAACGATCTTGCGAAAACTGGAAAATTGGATGATGCATTGGAACTGTTCGATGATATGTCT
GAAAGAAGAGTGGCACCTGATGTTACGTGTTATAATATCTTAATTGATGGGTTTCTTAAGGAAAAAGATCACAAGATGGC
TATGCAACTGTGGGACAAACTGTTGGAGGACTCTTCTGTTTATCCGAATGTTAAGACTCACAACATCATGATTAGTGGTT
TGAGCAAATGTGGAAGAGTAGATGATTGTTTGAAGATATGGGACAGAATGAAACAGAATGAGCGAGAAAAAGATTTGTAT
ACATATAGCAGTTTGATACATGGGCTGTGCGATGAAGGGAATGTTGATAAGGCTGAAAGTGTGTTTAACGAGTTGGTCGA
AAGGAAGGCCTTTATTGATGTGGTTACATACAATACTATGCTTGGTGGGTTTTGCCGTTGTGGGAAAATTAAGGAGAGTT
TGGAGTTATGGAGAATCATGGAGCAGAGGAATTCAGTTAACATAGTGAGTTATAACATTTTGATAAAAGGGTTGTTGGAG
AATGGGAAGATCGATGAAGCAACAATGATTTGGAGGCTTATGCCTGCCAAGGGCTATGCAGCTGACAACACAACTTATGG
TATTTTTATTCACGGGTTATGTGTGAATGGTTATGTAAATAAAGCCTTGGGGGTGATGCAAGAGGTGGAGAGCAAAGAGG
AGGAAGAGAACTACGTTGAAGCTGGCGACTTTGAGATTCTCAATGATTCCGGCGAACTAATTGGGGAAAAAAGCGACGAG
ATTGTTGAAGTTAGAGAGGAGATTGAAGAAGCGGAGAAACCAGAAAAGGGTTTAAGCGAAGAGGAGTTGAAGCCGATAAA
GGATCACATAGATCTTGATACTCAAACCAAGAAGCCATCAGTGCGACGAAGTTTTTGGTCGGCGGCCTCTGTTTTCAGCA
AGAAGCTTCAGAAATGGAGGCAGAATCAAAAGATGAAGAAGCGGCGGAACGGCGGCGACCATCGGCCGGGATCAGCTAGA
TTACCGGTGGAAAAGCCGATTGGGAGACAGCTCCGGGATACTCAATCGGAGATTGCTGATTACGGATTCGGTCGGAGGTC
GTGCGATACCGACCCTCGATTCTCTCTCGACGCCGGAAGATTCTCTCTTGACGCCGGAAGATTCTCCGTTGATATCGGTA
GGATCTCGCTTGATGACCCTCGTTACTCGTTTGACGAGCCGAGAGCTTCTTGGGACGGATCTTTGATCGGACGGACAGCT
TTTCCTCCTGCCGTGAGAGCTCCTCCGCCGCCGTCAATGCTTTCAGTGGTGGAGGATGCGCCGCCGCCGTTGCACCGTCA
CGTAACCCGAGCGGATATGCAGTTTCCGGTGGAAGAACCGGCGCCGCCACCACCGGTGGTTAACCAAAGTAACGGTGTGT
CCGACCCGGTTATCCTCCCAGGCGGGTCAATCCAAACCCGAGACTACTACACTGACTCATCGTCTCGGAGGCGGAAGAGT
CTCGACAGGTCTAGCTCCATGAGGAAGACGGCTGCAGCGGTTGTGGCTGATATGGACGAGCCAAAACTTTCAGTGTCGTC
GGCTATATCAATTGACGCTTACTCAGGATCACTGAGAGACAACAATTACGCGGCGGAGACGACGGATAACGGATTTTTCC
GGGAACCGGCGGTGATGATCGGCGAGAGGAAAGTGAATAGTAACGATAGTAATAAGAAATCGAGACGGTGGGGGAAATGG
AGCATCTTAGGGCTTATTTACAGGAAGAGTGTTAACAAGTATGAGGAAGAGGAGGAGGAAGAGGATAGGTATAGGAGATT
AAACGGTGGAATGGTGGAGAGATCGTTATCGGAGTCGTGGCCGGAACTGAGAAACTGTGGAGGAGTAGGAGGAGGGCCGA
GGATGGTGAGGAGTAATAGCAATGTGAGCTGGAGGAGTTCCGGTGGTGGATCAGCGAGGAAAGTCAACGGATTGGATAGG
AGGAACAAGAGTTCAAGGTACTCACCTAAGAATGGGGAAAACGGAATGTTGAAGTTTTACTTGCCACATATGAAAGGTAG
CCGGAGAATGAGCAGTGCAGGAGGAGGAGGCGGTGGTGGTGGTGGAGGCGGCGGGTGGGCGAATAGTCACGGGCATTCTA
TAGCGAGGAGTGTAATGAGGCTGTATTGA