Details for Lyrate rockcress Locus 16057514

Position : sca2 ( 5`- 15848051 .. 15851485 -3` )
Annotation : [B2G] alpha beta fold family protein
External links : CoGe
PGDD synteny : 16057514

Protein [Map View]
MICSSKGTTLIASGKNSNSIPRLPLTGSSTNRIQIRNPISVEKTFRRSSSSSSSMAVETMSMGSDSSTLILTSGASGRVR
VLFSMRELKRLVTFIQSLILFLLLPFRVVVWRRRTGAVVIRDDKQERKVWSPPQIVVRKRNIGGESGCSVSPPSVPAAVV
DEEVAVRRELAIKRVLEDEGGDGSSVRDYSLFTTKRGDTLFTQSWSPLSPNHRGLIVLLHGLNEHSGRYSDFAKQLNANG
FKVYGIDWIGHGGSDGLHAYIPSLDYAVADLKSFLEKVFTENPGLPCFCFGHSTGGAIILKAMLDPKIESRVSGIVLTSP
AVGVQPSHPIFAVLAPIMAFLLPRYQISAANKKGMPVSRDPAALIAKYSDPLVFTGSIRVKTGYEILRITAHLQQNLNKV
KVPFLVMHGTDDTVTDPNASKKLYEVASSSDKSIKLYDGLLHDLLFEPEREIISGAIIDWLNQRV*

DNA
ATGATCTGTTCAAGTAAAGGAACAACCTTAATCGCTAGCGGAAAAAATTCAAATTCAATCCCAAGATTACCCCTAACAGG
GTCATCCACAAATCGGATTCAAATTCGAAACCCAATCAGTGTCGAAAAAACATTCCGACGATCATCGTCATCGTCATCAT
CAATGGCGGTGGAAACAATGTCGATGGGATCAGATTCATCAACTTTGATTCTAACATCTGGAGCAAGCGGTCGCGTTAGG
GTACTCTTCTCGATGCGAGAGCTCAAGCGTCTCGTCACGTTTATCCAGTCGTTGATTCTCTTCCTCCTCCTTCCTTTTCG
CGTCGTCGTTTGGCGGAGGAGGACTGGTGCGGTGGTCATCAGAGACGATAAACAGGAGAGAAAGGTTTGGTCTCCGCCGC
AGATCGTGGTGAGGAAGAGGAACATCGGTGGCGAAAGCGGATGCAGCGTTTCGCCTCCGTCGGTTCCGGCGGCGGTGGTA
GATGAGGAGGTTGCTGTTAGACGTGAGCTGGCGATTAAGCGAGTATTGGAAGATGAAGGCGGCGATGGAAGCTCCGTCAG
AGATTATTCGCTTTTCACGACGAAGAGAGGGGATACGTTGTTTACTCAGTCATGGTCACCTCTTTCCCCAAATCACAGGG
GACTTATTGTTCTGCTACATGGATTAAACGAGCATAGTGGCAGGTATAGTGATTTTGCAAAGCAGCTTAATGCTAATGGG
TTCAAGGTCTATGGAATTGACTGGATCGGTCATGGCGGAAGTGATGGACTTCATGCTTACATTCCTTCCCTTGATTACGC
TGTAGCAGATTTGAAATCATTTCTTGAAAAGGTATTCACAGAGAATCCAGGACTCCCCTGTTTCTGCTTTGGACACTCAA
CAGGTGGAGCAATCATCCTCAAGGCTATGCTGGATCCAAAGATTGAATCTCGAGTTTCAGGCATTGTATTGACTTCACCA
GCTGTTGGAGTCCAACCATCCCATCCAATCTTCGCAGTTCTTGCTCCAATCATGGCGTTCCTCCTGCCCAGGTACCAAAT
CAGTGCAGCAAACAAGAAAGGAATGCCGGTCTCTCGTGACCCAGCAGCTCTTATCGCCAAATACTCTGACCCGTTAGTCT
TCACCGGATCCATCCGAGTTAAAACTGGCTACGAGATCCTTAGAATCACTGCTCACTTGCAACAGAACCTGAACAAAGTG
AAAGTTCCTTTTCTTGTGATGCACGGTACAGACGACACAGTAACCGATCCTAACGCTTCAAAGAAGCTCTACGAGGTAGC
TTCCTCGTCAGACAAATCAATCAAGCTCTACGACGGATTGTTGCACGATCTTCTCTTCGAACCCGAACGAGAAATCATCT
CTGGAGCCATAATAGATTGGCTAAACCAGCGGGTTTAG