Details for Lyrate rockcress Locus 16057502

Position : sca3 ( 5`- 801857 .. 802393 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057502

Protein [Map View]
MMPAKTTTTLVFTYGTLKRGFSNHVLMQDLIRSGDASFKGVYQTLDKYPLVCGPYRVPFLLNKPGSGHHVTGELYAVSPR
GLSRLDELEGISRGHYVRQQIRLAAAEDLETETSSSSCVVEAYYAHKSYEEELWKRNRGRSFGAYTENEARGYVKRNDRP
QHLSFLDHIRIFVSSPCD*

DNA
ATGATGCCGGCGAAAACAACAACAACGCTCGTGTTCACGTACGGAACTCTGAAACGAGGATTCTCAAATCATGTCCTGAT
GCAAGATCTGATCCGATCCGGTGACGCTTCTTTCAAAGGAGTTTACCAAACTCTAGACAAATATCCTCTCGTCTGTGGAC
CTTATCGAGTCCCTTTCCTCCTCAACAAACCTGGATCAGGTCATCACGTTACCGGCGAGCTTTACGCGGTTTCTCCTCGC
GGTCTCTCTCGTCTCGACGAGCTCGAAGGGATTAGTCGCGGTCATTACGTCCGGCAACAGATCCGTCTCGCAGCGGCGGA
GGATCTGGAAACGGAGACGTCTTCGTCGTCGTGCGTGGTGGAGGCATATTACGCGCATAAGAGCTACGAGGAAGAGCTGT
GGAAGAGGAATAGAGGAAGATCGTTTGGCGCGTATACGGAAAACGAAGCGCGTGGGTATGTGAAACGCAATGATAGGCCT
CAGCATCTTAGCTTCTTGGATCATATCCGTATTTTCGTATCTTCTCCATGTGACTGA