Details for Lyrate rockcress Locus 16057453

Position : sca3 ( 5`- 5980025 .. 5979377 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478848 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057453

Protein [Map View]
MKESDAVNLIHLGINIGFALFFFRISSVVVSCLIKCYSYTHDDDHHDPDHDNNNNDDHVSITIRQCVGIKPYVLRSIPII
DFNSKDFKDDVLECVVCLSELADRDKARVLPSCDHLFHVECIDSWLQSNSTCPICRKRVCLKQSRILTQNHDPTSEHHDE
FPTGVPTNTDTRLLKMVVAAKHSGERDKSGPC*

DNA
ATGAAAGAATCAGATGCCGTCAATCTAATACATCTCGGAATAAATATTGGCTTCGCTTTGTTTTTCTTTAGGATTTCGTC
CGTGGTAGTGAGTTGTCTTATTAAATGTTATAGTTATACTCATGATGATGATCATCATGATCCTGATCATGACAACAACA
ACAACGATGATCATGTCAGCATCACCATCAGGCAATGTGTAGGAATAAAGCCGTATGTTCTCCGATCGATCCCTATCATA
GACTTCAACTCCAAAGACTTCAAAGACGACGTCCTCGAATGCGTCGTTTGTCTCTCGGAGCTAGCCGACAGAGACAAAGC
TAGGGTTTTGCCGAGCTGCGATCACTTGTTTCACGTTGAATGTATCGACTCGTGGCTTCAATCAAACTCCACTTGTCCTA
TATGTAGAAAGAGAGTTTGTTTGAAGCAGTCACGAATTTTGACCCAAAATCACGACCCGACATCAGAACATCATGATGAG
TTTCCGACAGGTGTTCCGACGAACACAGACACGCGATTATTGAAGATGGTGGTTGCGGCGAAACATTCCGGCGAAAGAGA
TAAATCAGGCCCATGTTAG