Details for Lyrate rockcress Locus 16057446

Position : sca3 ( 5`- 7980060 .. 7980737 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479364 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057446

Protein [Map View]
MDSSKKIILVTFIVSFYMFSCVSSTEFEVGGEDGWIVPKSKTLGDAFNQWASDNRFKVGDTLRFKYTKDSVLVVSEEEYK
KCKATKPQLYSNNEDTVFKLDRPGLFYFISGVSGHCEKGQKMIVKVMETESSTESPPPSSSSSSSSSSSLPASTPKAKKS
NAYKTAVQFSSSGFVVFAVLVVSVFGLV*

DNA
ATGGATTCATCGAAGAAGATCATTCTCGTTACGTTTATTGTATCATTTTACATGTTTTCATGTGTATCAAGCACTGAATT
TGAAGTTGGAGGAGAAGATGGGTGGATCGTACCAAAGTCTAAGACTCTTGGAGATGCGTTTAACCAATGGGCTTCAGATA
ACCGGTTTAAAGTTGGCGACACTCTCCGTTTCAAGTACACGAAAGACTCAGTGTTAGTGGTGTCAGAAGAAGAGTACAAG
AAATGCAAAGCGACCAAACCGCAACTCTACTCAAACAACGAAGACACTGTTTTCAAACTAGACCGACCCGGTTTGTTTTA
CTTCATCAGCGGTGTCTCTGGCCACTGCGAAAAGGGTCAGAAGATGATCGTAAAAGTTATGGAGACTGAGTCTTCCACAG
AGTCTCCTCCTCCTTCATCTTCATCTTCATCTTCGTCATCATCATCTCTTCCGGCTTCAACTCCCAAGGCCAAGAAGAGC
AATGCCTACAAAACCGCGGTCCAGTTCAGTAGTTCCGGTTTTGTTGTCTTTGCCGTTCTTGTTGTTTCAGTTTTTGGTTT
GGTTTAG