Details for Lyrate rockcress Locus 16057444

Position : sca3 ( 5`- 1660719 .. 1659334 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477746 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057444

Protein [Map View]
MAANGGAAAAGKLSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRNDGIYIINLGKTWDKLQMAARVIVAIENPKDII
VQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDPRTDHQPIKEGALGNIPTIAFCDTDSPMG
FVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTILRAQKWDVMVKSRNTYHSMFLQHQKKDVDLFVLCRWICFSTGSPKK
QSKTMMKNMEWLVVTSGPLLKSLMLHGLVNPNSRFLLHLQLAVSFLLLLDGTLLLFQLLVGSKSSLHFSLARIRLGED*

DNA
ATGGCGGCGAATGGAGGAGCTGCGGCGGCTGGTAAGCTGTCAGAGAAAGAAGCTGATATCCAGATGATGTTATCAGCCGA
TGTTCACCTTGGTACCAAAAATTGCAATTATCAGATGGAGCGTTATGTCTTCAAAAGACGCAACGACGGTATTTACATTA
TCAATCTTGGAAAGACATGGGACAAGCTTCAGATGGCTGCTAGGGTTATTGTAGCAATCGAAAACCCTAAAGACATAATT
GTGCAATCAGCTAGGCCTTATGGGCAAAGAGCTGTCTTGAAGTTTGCTCAGTACACTGGTGCTAATGCAATTGCTGGAAG
ACACACTCCTGGTACTTTCACTAACCAAATGCAGACTTCTTTCAGTGAGCCCAGGTTGTTGATTCTCACCGACCCAAGAA
CCGACCATCAGCCAATTAAGGAAGGTGCGTTGGGAAACATTCCGACTATCGCCTTCTGTGACACCGATTCTCCAATGGGA
TTTGTCGACATTGGTATTCCTGCTAACAACAAGGGAAAACACAGCATTGGTTGCCTGTTTTGGCTTTTGGCTCGTATGGT
TCTCCAAATGCGTGGAACCATTCTCCGAGCTCAGAAATGGGATGTCATGGTAAAGTCTAGAAACACTTATCACTCTATGT
TTCTCCAACACCAAAAAAAAGATGTTGACTTGTTTGTGTTGTGTAGGTGGATCTGTTTTTCTACAGGGAGCCCGAAGAAG
CAAAGCAAGACGATGATGAAGAATATGGAATGGTTGGTGGTGACCAGTGGACCACTGCTCAAATCCCTGATGCTGCATGG
CCTGGTGAACCCGAACAGCCGATTTCTGCTGCACCTGCAGTTGGCGGTTAGTTTCTTGTTGCTGCTGGATGGGACACTGC
TTCTGTTCCAGCTGCTGGTTGGGAGTAAAAGTTCCCTTCATTTTAGTTTAGCTCGAATTCGGTTAGGAGAGGATTAG