Details for Lyrate rockcress Locus 16057406

Position : sca3 ( 5`- 11778160 .. 11774572 -3` )
Annotation : [B2G] tms membrane family protein
External links : CoGe
PGDD synteny : 16057406

Protein [Map View]
METGTSVSNNSGSIRNDSYEAIKNGSWFNQFRNGCNPWMARYVYGLIFLIANLLAWAARDYGRGALRKVTKFKNCKGGEN
CLGTDGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSSIIHLYGEIAHFGAGVFL
LIQLISVISFIQWLNECYQSQKDAERCRVYVMLLATTSYTVCIVGVILMYIWYAPDSSCLLNIFFITWTLFLIQLMTSIA
LHPKVNAGYLTPALMGLYVVFICWCAIRSEPVGESCNRKAAASNRTDWLTIISFVVALLAMVIATFSTGIDSQCFQFKKD
ENDQEEEEEDGVPYGYGFFHFVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPLILK
SRRQPTSGT*

DNA
ATGGAGACCGGTACAAGTGTTAGTAACAACAGCGGAAGCATCAGAAACGATAGCTATGAAGCAATCAAGAATGGATCATG
GTTTAATCAGTTCCGCAATGGTTGCAATCCATGGATGGCTAGATATGTATACGGTCTGATATTTCTCATCGCGAATCTAC
TAGCTTGGGCTGCTCGTGATTATGGTCGGGGGGCCTTAAGAAAAGTAACAAAATTCAAGAACTGTAAAGGCGGAGAAAAC
TGTTTGGGGACCGACGGTGTCTTAAGAGTTAGCTTGGGATGTTTTTTGTTCTACTTTGTTATGTTTCTTTCAACGCTTGG
CACGTCGAAAACGCATTCATCAAGAGATAGATGGCATTCTGGATGGTGGTTTGCTAAGCTTATCCTGTGGCCTGCCTTAA
CCATAATCCCCTTCTTGCTTCCTTCTTCCATTATTCATCTTTACGGAGAGATTGCCCATTTTGGTGCAGGGGTATTTCTT
CTAATACAGCTAATTAGTGTGATCAGTTTCATTCAATGGCTTAACGAATGCTATCAGTCCCAAAAAGATGCAGAAAGATG
CCGTGTCTATGTGATGTTACTAGCAACTACTTCATACACAGTTTGCATAGTAGGAGTGATTTTGATGTACATTTGGTACG
CGCCTGATTCGTCATGCCTTCTCAATATATTCTTCATAACATGGACTTTGTTCCTTATCCAACTCATGACAAGCATCGCT
CTCCATCCGAAAGTGAATGCCGGATACTTGACTCCAGCTCTTATGGGACTCTATGTTGTGTTTATATGCTGGTGTGCCAT
TCGAAGTGAACCAGTGGGAGAAAGTTGCAATAGAAAAGCAGCAGCTTCGAACAGAACGGACTGGCTTACCATCATTAGCT
TTGTGGTTGCGCTACTCGCAATGGTTATTGCCACATTTTCTACAGGAATAGACTCCCAATGTTTCCAATTCAAGAAAGAT
GAGAACGATCAAGAAGAAGAAGAGGAAGATGGTGTTCCTTATGGATATGGATTCTTCCATTTTGTTTTTGCCACAGGAGC
AATGTACTTCGCTATGCTACTCATCGGTTGGAACACTCATCACCCCATGAAAAAGTGGACAATTGACGTGGGATGGACGA
GTACTTGGGTTAGGGTTGTGAACGAGTGGCTTGCGGTTTGCGTATACATTTGGATGTTGGTGGCTCCTCTCATACTAAAG
AGCAGAAGACAACCAACAAGTGGGACATGA