Details for Lyrate rockcress Locus 16057405

Position : sca3 ( 5`- 4262500 .. 4263817 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317863 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057405

Protein [Map View]
MALYRSLVLHHRPTSPTVIPLFRNYPSKALKFSSLPFLHRCSKSQVSSSSARCCSSSSSSSMESPPEGYRRNVGVCLMNS
SKKIFTASRLDIPSAWQMPQGGIDEGEDPRVAVMRELKEETGVHSAEIVAEAPHWITYDFPPDVREKLKVRWGSDWKGQA
QKWFLLKFTGKDEEINLLGDGTEKPEFGEWSWTSPDQVIEHAVDFKKPVYKEVMSAFASHLQ*

DNA
ATGGCATTGTACCGATCGCTTGTCTTGCATCATCGCCCAACATCTCCGACAGTAATTCCGTTATTCCGAAATTACCCCTC
GAAAGCGCTGAAATTCTCGAGCCTGCCCTTCCTCCACCGCTGCAGTAAGTCTCAGGTCTCCTCCTCCTCCGCTCGGTGTT
GTTCTTCATCGTCGTCGTCTTCCATGGAATCTCCTCCGGAAGGTTACAGAAGAAATGTCGGTGTCTGCCTCATGAACTCT
TCCAAAAAGATTTTCACTGCCTCGAGGTTGGATATTCCCAGTGCTTGGCAAATGCCTCAGGGTGGAATCGATGAGGGTGA
AGATCCAAGAGTTGCAGTCATGCGAGAGCTTAAAGAAGAGACTGGAGTCCACTCTGCTGAGATTGTCGCTGAGGCACCTC
ACTGGATAACCTACGACTTCCCCCCTGATGTTAGAGAGAAGCTCAAGGTCCGATGGGGTTCTGATTGGAAGGGTCAAGCA
CAGAAATGGTTTCTGCTGAAATTTACTGGGAAAGATGAAGAAATCAATCTTCTTGGTGATGGTACTGAGAAACCTGAGTT
CGGTGAATGGTCCTGGACATCTCCTGATCAAGTCATTGAACATGCAGTGGATTTCAAGAAGCCAGTGTACAAGGAAGTCA
TGTCAGCTTTCGCTTCTCATCTCCAGTAA