Details for Lyrate rockcress Locus 16057403

Position : sca3 ( 5`- 1271614 .. 1273247 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057403

Protein [Map View]
MDLEDWELVLPKNSFKDLDLDHDEDHHGAMVMDYFLCPSTKDPLPKTESPPRTIVVPKKLLQVPIAWEAVLDQDNTKKPN
NREPDPDPDSKQTLSTDFVSSPRVSFKIMKETEFADMKIDPPARITSPLPQIDDAASKPSDLEGGGDLRNKEEVVLEEVD
EDGSGGERLNLWKVGLNGIGAICSFGVAAAAATVCVFFLGHNNIKICKNKNQMLRFQIYSDDNKRMKEVVNHATKLNEAI
FGMKGVPVVRAQISFGGHYDGL*

DNA
ATGGATCTCGAGGATTGGGAATTAGTACTCCCCAAGAACAGCTTCAAGGATCTTGATCTTGATCATGACGAGGATCATCA
TGGAGCGATGGTAATGGACTACTTCCTCTGCCCATCTACTAAAGATCCTCTCCCAAAAACAGAGTCTCCTCCAAGAACCA
TAGTGGTCCCTAAAAAGCTTCTTCAAGTTCCCATAGCCTGGGAAGCCGTTTTGGACCAAGACAACACGAAGAAACCCAAT
AACCGTGAACCGGATCCAGATCCGGATTCAAAACAAACCCTTTCGACGGACTTTGTTTCGTCACCTAGAGTTTCCTTCAA
GATAATGAAGGAGACTGAATTTGCCGACATGAAAATTGACCCACCAGCGAGGATCACGAGTCCTCTGCCTCAGATCGATG
ATGCTGCATCGAAACCCTCTGATTTAGAAGGAGGAGGTGACTTGCGAAACAAGGAAGAAGTTGTGTTGGAGGAAGTAGAT
GAAGATGGTAGTGGTGGTGAGAGATTGAATCTGTGGAAGGTTGGTCTCAATGGGATTGGAGCAATCTGTTCTTTTGGGGT
CGCAGCTGCTGCTGCTACTGTATGTGTCTTCTTCCTCGGACACAACAATATCAAAATCTGTAAGAACAAGAACCAGATGC
TTAGGTTCCAGATTTACTCCGATGATAATAAGAGGATGAAAGAAGTTGTGAATCATGCAACAAAGCTCAATGAAGCAATC
TTTGGTATGAAAGGTGTTCCTGTCGTAAGAGCTCAAATATCTTTTGGGGGTCACTACGATGGACTTTGA