Details for Lyrate rockcress Locus 16057397

Position : sca3 ( 5`- 4235322 .. 4229519 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317855 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057397

Protein [Map View]
MALKIIDVDVKPRHRLFISLSHDAAETTVWASKMDGTGSWDTLEWTKLDSASGSGSGSGSFSNLSCLLESERVIVEGYGV
VLINTDEAGTLLVTNFRILFLSEGTRKVIPLGTIPLATIEKFNKMVLKVQSSPRQSDKNPPRRLLQVTGKDMRIIVYGFR
PRTKQRRNVFDALLKCSKPERVWDLYTFACGPSKFGNTNPKERLLNEYFRLLGRSSIRASMDMIEDGSFTLFNELWRISD
LNSNYNLCQTYPFAFMVPKSIRDEELLQACSFRARCRLPVITWCQPGSGAVIARSSQPLVGLMMNMRSNLDEKLVAAFCS
QLPGAKGERRKLYIADARPRKNALANGAMGGGSESSSNYFQSEIVFFGIDNIHAMRESFSRVRDYLDMHGTTSSDGRSSF
LRHGGWTWGGGNLSSMSASVSLLGDSGWLIHIQSVLAGAAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYR
TFAGFQALVEKDWLAFGHPFSDRVGMPNISGSGNFDLPRHSSHGHNNYSPIFMQWIDSVSQLMRMYPCAFEFSPTFLVDF
MDCLLSCRFGNFLCNSEKEREQCGIADACGCLWAYLTDLRSFSATHVHCNPFYDPLKYDGPLLPPAASLAPTLWPQFHLR
WACPEEAKAADIGVQCRAMTVKYSEMQKEKEAAERRVDEISFAMESLSAELLRERHLSWVARESANRATKEYAALTRAVQ
SLGCKINFTTSDVEDDPRSSLENNPRRRNRHGNNSDVSVSISLMSEENTSGNPIGRVCEALCPLRTREGVCRWPEVGCAH
VGSQFVGLKANFDAFDRLAIYDSYFQPE*

DNA
ATGGCTTTGAAGATCATTGATGTTGATGTGAAGCCTCGTCACCGTCTCTTTATCTCCCTTTCTCATGACGCCGCCGAGAC
CACCGTCTGGGCGAGCAAGATGGATGGTACCGGTAGTTGGGACACGCTTGAATGGACCAAACTCGATTCAGCTTCAGGGT
CAGGGTCAGGTTCAGGTTCTTTCTCGAATTTGAGTTGCTTGCTGGAATCGGAGAGGGTCATCGTCGAGGGTTATGGAGTT
GTTCTTATTAACACCGACGAAGCAGGAACTCTATTGGTGACAAATTTCCGTATTCTTTTTCTGAGTGAAGGAACCAGAAA
AGTCATTCCACTTGGAACCATTCCATTGGCAACCATTGAGAAGTTTAACAAAATGGTGCTGAAAGTTCAGTCAAGCCCCC
GTCAGTCTGACAAGAATCCACCAAGACGTCTTTTACAGGTCACTGGCAAAGACATGAGGATAATTGTTTATGGCTTTCGT
CCTCGCACCAAGCAGAGACGTAATGTGTTTGATGCATTACTGAAGTGTAGCAAGCCAGAGAGAGTATGGGATCTATATAC
TTTTGCATGCGGTCCTTCCAAATTTGGTAACACAAACCCAAAGGAAAGATTGCTTAATGAATATTTCCGTCTTCTCGGAA
GAAGTTCAATACGAGCATCAATGGATATGATTGAAGATGGTTCGTTCACATTGTTCAACGAGCTGTGGCGGATAAGCGAC
TTGAACTCCAATTACAACTTGTGTCAGACTTATCCATTTGCTTTTATGGTTCCAAAATCCATACGTGATGAAGAGCTGCT
CCAGGCGTGTTCTTTCCGAGCAAGATGTCGCTTACCTGTGATCACGTGGTGTCAGCCAGGAAGTGGAGCTGTGATTGCAC
GCTCATCACAACCTTTAGTGGGTCTTATGATGAATATGAGGAGTAATCTTGATGAAAAACTTGTTGCTGCATTCTGCTCT
CAATTACCTGGTGCTAAGGGAGAACGAAGGAAGCTTTATATTGCCGATGCAAGACCTAGGAAGAATGCATTAGCCAATGG
AGCAATGGGAGGTGGCTCAGAATCATCTTCCAATTATTTTCAATCTGAAATTGTTTTCTTTGGCATAGACAACATACATG
CAATGAGGGAGAGCTTTTCCCGCGTTAGAGATTATTTAGATATGCATGGTACAACATCATCTGATGGGAGATCATCGTTC
TTGAGACACGGTGGTTGGACCTGGGGAGGAGGTAATCTTAGTAGTATGTCTGCTTCAGTATCTTTACTTGGAGATAGTGG
CTGGTTGATACACATCCAGAGCGTCTTAGCTGGTGCAGCATGGATAGCTGCACGTGTTGCTATGGAGTCGGCATCAGTTC
TTGTGCACTGCAGTGATGGATGGGACCGAACAACTCAGCTTGTTTCTCTTGCATGCTTATTGCTTGATCCATACTACAGA
ACTTTTGCTGGGTTTCAGGCTCTTGTCGAAAAGGATTGGCTTGCTTTTGGTCACCCATTTTCGGATCGTGTAGGAATGCC
TAACATATCAGGATCTGGTAATTTTGACTTACCAAGGCACTCTTCCCATGGACATAACAATTATTCACCTATATTTATGC
AGTGGATTGATAGCGTTTCACAGCTAATGCGGATGTATCCTTGTGCTTTTGAGTTTTCTCCGACTTTCCTGGTAGATTTT
ATGGATTGCTTGCTTTCATGTCGTTTTGGGAACTTCTTATGCAACAGTGAAAAAGAGAGGGAACAATGTGGGATTGCTGA
TGCCTGTGGATGCCTATGGGCATATTTGACTGATCTGCGTTCATTTAGTGCAACTCATGTCCATTGTAACCCATTCTACG
ATCCTTTGAAATATGACGGCCCATTACTACCTCCAGCAGCATCTCTAGCTCCTACCCTTTGGCCCCAGTTCCATCTGCGG
TGGGCTTGTCCCGAGGAAGCTAAAGCTGCAGATATCGGGGTCCAATGTAGAGCCATGACAGTGAAATATTCTGAAATGCA
AAAGGAGAAAGAAGCAGCAGAAAGAAGAGTGGACGAGATATCTTTCGCAATGGAGTCATTAAGTGCAGAGTTGCTAAGAG
AAAGGCATTTGAGTTGGGTAGCTAGAGAATCAGCAAATCGAGCTACCAAGGAATATGCAGCTTTAACCCGAGCAGTACAA
TCACTCGGGTGCAAGATTAACTTCACCACATCTGATGTTGAAGACGACCCAAGGAGTTCTCTGGAGAATAACCCTAGGAG
ACGAAACAGACACGGGAACAACTCAGATGTTTCTGTATCAATCTCACTAATGTCTGAAGAAAATACATCTGGAAACCCGA
TAGGACGGGTTTGTGAAGCGTTGTGTCCATTGCGTACAAGAGAAGGAGTATGTCGATGGCCTGAAGTTGGATGTGCTCAT
GTTGGAAGTCAGTTTGTTGGGTTAAAAGCAAATTTTGATGCGTTTGATCGGCTTGCCATCTACGATAGCTACTTCCAACC
TGAATGA