Details for Lyrate rockcress Locus 16057377

Position : sca3 ( 5`- 6828137 .. 6826975 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897928 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057377

Protein [Map View]
MGSVQLNGSGLVASLPPNHSFSHKTKLSNPKSYFLRSKHNAAGTKTVRAISTAPASQPPAADEPDEPPAVDFAFVHSVLL
PDGTPDVHWRRACGGQKLRDIMLDSNIELYGPYSKPLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRL
ACQTNVGNPDSTGLVVIQQLPEWKAHEWNIPKNIPNDDDLETST*

DNA
ATGGGAAGTGTACAGTTGAATGGTTCAGGCTTAGTAGCTTCTCTACCTCCAAATCATAGCTTTAGCCACAAAACCAAACT
TAGTAATCCTAAGTCATACTTCTTGCGCTCAAAACACAATGCCGCCGGAACCAAAACCGTCCGAGCCATAAGCACCGCAC
CAGCTAGCCAGCCTCCAGCCGCAGATGAGCCCGACGAACCTCCTGCTGTCGATTTTGCGTTCGTCCATTCGGTGTTGTTG
CCGGACGGGACACCGGACGTGCATTGGAGAAGAGCGTGTGGTGGACAGAAACTAAGAGACATAATGTTGGATTCTAACAT
CGAACTCTATGGTCCTTATAGTAAGCCTTTGTCAAACTGCGCAGGAGTAGGAACTTGCGCTACTTGCATGGTCGAGATTG
TAAATGGAAAGGAGCTTCTAAATCCACGAACTGATATTGAAAAGGAGAAACTCAAAAGGAAACCAAAAAATTGGAGACTA
GCTTGTCAAACCAACGTGGGAAATCCAGATTCTACCGGATTGGTTGTCATACAACAATTGCCAGAGTGGAAAGCTCATGA
ATGGAACATCCCTAAGAATATACCTAATGACGATGATCTCGAAACTTCTACGTGA