Details for Lyrate rockcress Locus 16057372

Position : sca3 ( 5`- 4642425 .. 4640285 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897360 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16057372

Protein [Map View]
MSVNHYHNTLSLHQHHQNDVAISQRESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNNNGGDDDVATTEKGMLLSFEDE
SGKCWKFRYSYWNSSQSYVLTKGWSRYVKDKHLDAGDVVFFQRHRFDLHRLFIGWRRRGEASSSPAVSAVSQEALVNTTA
YWSGMTTPYRQVHASTTYPNIHQEYSHYGAVADQAQSIPPVVAGSSRTVRLFGVNLECHGDAVEPPPRPDGYNGQHIYYY
STPHPMNISFAGEALEQVGDGRG*

DNA
ATGTCAGTCAACCATTACCACAACACTCTCTCGTTGCATCAACACCACCAAAACGACGTAGCCATATCACAAAGAGAGTC
TTTGTTCGAGAAATCACTCACACCAAGCGACGTCGGAAAGCTAAACCGCTTAGTCATACCAAAACAACACGCCGAGAAAT
ACTTCCCTCTCAATAATAATGGCGGCGACGATGACGTGGCGACGACGGAGAAAGGGATGCTTCTTAGCTTCGAGGATGAG
TCAGGCAAGTGTTGGAAATTCAGATACTCTTATTGGAACAGTAGCCAGAGCTACGTGTTGACCAAAGGATGGAGTAGGTA
CGTCAAAGACAAACACCTCGACGCAGGCGACGTTGTTTTCTTTCAACGTCACCGTTTTGATCTCCATAGACTCTTCATTG
GCTGGCGGAGACGCGGTGAAGCTTCTTCATCTCCCGCCGTCTCCGCCGTGTCTCAAGAAGCTTTAGTTAATACGACGGCG
TATTGGAGCGGCATGACCACACCTTATCGTCAAGTACACGCGTCAACTACTTACCCTAATATTCACCAAGAGTATTCACA
CTATGGCGCCGTCGCTGATCAGGCTCAGTCGATACCACCGGTGGTCGCAGGGAGTTCGAGGACGGTGAGGCTATTTGGCG
TGAACCTTGAATGTCACGGTGATGCCGTCGAGCCACCACCGCGTCCAGACGGCTATAATGGCCAACACATTTACTATTAC
TCAACTCCTCATCCCATGAATATATCATTTGCTGGGGAAGCATTGGAGCAGGTAGGAGATGGACGAGGTTGA