Details for Lyrate rockcress Locus 16057337

Position : sca3 ( 5`- 2313853 .. 2313548 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057337

Protein [Map View]
MSSNGVWQSNNGYYSYGYGGGYVEKRQLFLKSYQFSRKQSLTEKIKISVKRVAKKVVWMRLKSARRLKRVVWSRFKTAFF
YRRRRFFRLLHPNKPSSYCFY*

DNA
ATGAGCAGCAACGGCGTTTGGCAGAGCAACAACGGTTACTATAGCTATGGATATGGAGGAGGATACGTGGAGAAGAGACA
ACTATTCCTTAAGAGCTACCAATTCTCAAGGAAACAGAGTTTAACAGAGAAGATCAAGATATCCGTGAAGAGAGTGGCGA
AGAAAGTTGTTTGGATGAGGTTGAAATCTGCTAGAAGACTGAAACGCGTCGTTTGGTCACGTTTCAAAACGGCGTTTTTC
TACCGCCGCAGACGTTTCTTTCGTCTCCTTCATCCAAACAAACCCTCTTCCTACTGTTTCTACTAG