Details for Lyrate rockcress Locus 16057328

Position : sca5 ( 5`- 17923352 .. 17922019 -3` )
Annotation : [B2G] wrky dna-binding protein 70
External links : CoGe
PGDD synteny : 16057328

Protein [Map View]
MDTNKAKKLKVMNQLVEGHELTTQLQQLVSQPGSGLGPAEDLVAKILGSFNNSISILDTFEPISSSFSSLAAVEGSQNAS
CDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKRSETWTKESTILEDAFSWRKYGQKEILNAKFPRSYFRCTHKYTKGCKAT
KQVQKVELDPKMFSITYIGNHTCNTNAETPKSKTCDHHDEIFMDSEEHKSPSLTTSMKEEEENHHHHGSSTENELSLVWP
EMVFEEDYHQQAIYVNGETSTSINDLGSPDHLVFGAGGDFGFIENEHFSIFSSCSNLS*

DNA
ATGGATACCAATAAAGCAAAAAAGCTTAAAGTGATGAACCAACTCGTTGAAGGCCACGAGTTAACCACTCAGCTTCAGCA
ACTCGTCTCTCAACCCGGGTCCGGTCTAGGTCCAGCGGAGGATCTAGTGGCTAAAATCTTAGGGTCTTTCAATAACAGCA
TCTCCATTCTTGATACCTTCGAACCCATCTCCTCCTCCTTCTCATCCCTCGCCGCCGTTGAGGGCTCTCAAAATGCTTCA
TGCGACAACGACGGCAAGTTTGAAGATTCCGGCGATAGTCGGAAAAGATTGGGACCCGTTAAGGGTAAAAGAGGATGCTA
CAAAAGAAAGAAAAGATCGGAGACGTGGACTAAAGAATCGACTATACTTGAGGACGCATTTTCTTGGAGGAAATATGGAC
AAAAGGAGATTCTTAATGCCAAATTCCCAAGGAGTTACTTTAGATGCACACACAAGTACACTAAAGGGTGCAAGGCAACA
AAGCAAGTCCAGAAGGTGGAGCTCGATCCCAAGATGTTCAGTATCACATACATAGGAAACCACACGTGTAACACCAACGC
AGAAACACCCAAGAGCAAGACTTGTGACCATCATGATGAGATCTTCATGGATTCCGAAGAGCACAAGAGTCCTAGTTTGA
CGACCTCAATGAAGGAGGAAGAAGAGAATCATCATCATCATGGTTCGTCCACGGAGAATGAGTTGTCATTGGTGTGGCCA
GAAATGGTTTTCGAAGAAGATTATCATCAGCAGGCCATTTACGTCAATGGGGAAACTAGTACATCTATCAATGATTTGGG
TTCTCCGGACCACTTGGTGTTTGGAGCTGGCGGCGATTTCGGGTTTATCGAAAATGAGCACTTCTCTATCTTCAGTTCAT
GTTCGAATCTATCTTGA