Details for Lyrate rockcress Locus 16057323

Position : sca3 ( 5`- 6161148 .. 6161755 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057323

Protein [Map View]
MEALWKLEEKLKLTTKEAVVILVGTAAAVTLLCIAAAFLSRNSRGKQVADAEWASETAFASRTMEEKRKCKWSKVKKTLM
GSFCWSSAAKWMEMETRRPPPLLAAKERSLNAVDPVWQRPILMGEKCELPRFSGLILYDERGHPRHHPQLQEQVKQISVV
RTTLRDLL*

DNA
ATGGAAGCCTTGTGGAAGTTGGAGGAGAAACTGAAGCTAACTACGAAAGAAGCTGTTGTGATCTTGGTCGGAACAGCGGC
TGCGGTAACGTTACTTTGCATAGCTGCAGCGTTTCTCAGCCGCAATTCTCGTGGGAAGCAAGTAGCAGACGCAGAGTGGG
CGTCCGAAACAGCGTTTGCGTCAAGGACTATGGAGGAAAAGAGGAAATGTAAGTGGAGCAAAGTGAAGAAAACGTTGATG
GGTTCGTTTTGTTGGAGCTCTGCAGCTAAGTGGATGGAGATGGAAACAAGGCGGCCGCCACCATTGCTTGCGGCTAAAGA
AAGGAGTCTTAACGCCGTTGATCCTGTTTGGCAGCGACCGATTCTGATGGGTGAGAAATGTGAATTGCCGCGGTTTAGCG
GCCTTATATTGTATGATGAACGCGGCCATCCGCGTCATCATCCTCAACTTCAAGAACAAGTAAAACAAATTTCTGTGGTA
AGAACAACGCTGAGAGATTTGCTTTGA