Details for Lyrate rockcress Locus 16057314

Position : sca3 ( 5`- 8427907 .. 8427581 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057314

Protein [Map View]
MKKVLRVYGGVLRLVRLLPADTRPYYAKYARENFVNYREVDQSETSLDELFQRAYNHSLWVLKKYSIDESAATKLKEICF
E*

DNA
ATGAAGAAAGTGCTGAGAGTTTACGGCGGCGTGTTGAGGCTAGTGAGGCTTTTACCGGCAGACACAAGGCCGTATTACGC
TAAGTACGCCAGGGAGAATTTCGTTAACTACCGTGAAGTCGACCAAAGCGAAACATCCCTCGACGAACTCTTTCAACGAG
CCTATAATCACTCACTTTGGGTACTCAAGAAGTACTCAATTGACGAATCAGCAGCGACGAAGTTGAAAGAGATTTGTTTT
GAATAA