Details for Lyrate rockcress Locus 16057305

Position : sca3 ( 5`- 9275323 .. 9274681 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057305

Protein [Map View]
MNYQATILAIFMIVLVLDCDDAMCVTMCKQKWKGSGGSCFQNVNLKSCLCAFPCQV*

DNA
ATGAATTACCAAGCCACCATTCTTGCTATCTTCATGATTGTCCTTGTTCTAGATTGCGATGATGCTATGTGTGTCACTAT
GTGTAAGCAAAAATGGAAGGGAAGTGGTGGCTCGTGTTTCCAAAACGTAAATTTAAAGAGTTGCCTTTGCGCTTTTCCAT
GCCAAGTTTGA