Details for Lyrate rockcress Locus 16057289

Position : sca3 ( 5`- 9835690 .. 9838164 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057289

Protein [Map View]
MAGSALPLPPPPPLSLQSPSQNQTRHSSTFSPPTLTPQTPSIRSRLSKICQEGNPQLARQLFDAIPKPTTVLWNTIIIGF
ICNNLPHEALLFYSRMKKTAPFTKCDAYTYSSTLKACAETKNLKAGKAVHCHLIRCLQNSSRVVHNSLMNMYVSCLNAPG
SELDCFEYDVVRKVFDNMRRKNVVAWNTLISWYVKTGRNAEACRQFAIMMRMEIKPSPVSFVNVFPAVATSRSIKKANVF
YGLMLKLGDEYVKDLFVVSSAISMYAELGDLESSRRVFDSCVERNIEVWNTMIGVYVQNDCLVESIELFLEAIGSKEIVS
DEVTFLLAASAVSGLQQVELGRQFHGFVSKNFRELPIVIINSLMVMYSRCGFVQKSFGVFHSMRERDVVSWNTMISAFVQ
NGLDDEGLMLVYEMQKQGFKIDYITVTALLSAASNLRNKEIGKQTHGFLIRQGIQFEGMNSYLIDMYAKSGLIRISQKLF
EGSGYAERDQATWNSMISGYTQNGHTEETFLVFRKMLEQNIRPNAVTVASILPACSQVGSVDLGKQLHGFSIRQYLDQNV
FVASALVDMYSKAGAIKYAENMFSQTKERNSVTYTTMILGYGQHGMGERAISLFLSMQELGIKPDAIAFVAVLSACSYSG
LVDEGLKIFEDMREVYNIQPSSEHYCCITDMLGRVGRVNEAYEFVKGLGEEGNIAELWGSLLGSCRLHGELELAETVSER
LAKLDKGKNFSGYEVLLSNMYAEEQNWKSVDRVRKGMREKGLKKEVGRSGIEVAGHVNCFVSRDQEHPHSGEIYDAIDGL
AKNMRGDSFLTTLPIVTPSLELDE*

DNA
ATGGCCGGATCAGCTCTACCTCTTCCACCGCCTCCACCACTATCATTACAATCTCCGTCGCAGAATCAAACCCGTCATTC
TTCTACCTTTTCTCCACCAACCCTCACTCCTCAAACACCTTCTATCCGTTCCCGTCTCAGTAAAATCTGTCAAGAAGGAA
ATCCTCAACTTGCACGCCAACTGTTCGACGCAATTCCTAAACCAACCACTGTTCTTTGGAACACTATCATCATCGGGTTT
ATTTGTAATAATCTGCCACACGAGGCTCTTCTTTTCTATTCCCGGATGAAAAAGACGGCACCTTTCACTAAATGTGATGC
TTATACTTACTCTTCTACACTCAAGGCGTGTGCTGAGACGAAGAATTTGAAAGCTGGTAAAGCTGTGCATTGTCATTTGA
TCCGTTGTTTACAGAATTCGAGCAGGGTTGTGCATAATTCTTTGATGAATATGTATGTTTCTTGTTTGAATGCTCCTGGA
AGTGAATTGGATTGTTTTGAGTACGATGTGGTGCGTAAAGTTTTCGATAATATGCGTAGGAAGAACGTTGTGGCTTGGAA
TACGTTGATTTCTTGGTATGTGAAAACAGGGAGAAATGCAGAAGCGTGTAGGCAATTTGCGATAATGATGAGAATGGAGA
TAAAACCGAGCCCGGTTAGCTTTGTTAATGTTTTTCCTGCGGTGGCGACTTCTAGAAGCATTAAGAAAGCTAATGTTTTT
TATGGTTTGATGCTTAAATTGGGAGATGAATATGTGAAGGACTTGTTTGTGGTTAGTTCGGCTATTTCTATGTATGCTGA
GCTTGGTGATCTGGAGTCATCAAGGAGAGTATTTGATTCTTGTGTTGAGAGAAACATCGAGGTTTGGAATACGATGATAG
GTGTTTATGTTCAGAATGATTGTCTAGTTGAAAGTATTGAGCTTTTTCTTGAAGCAATAGGATCGAAAGAGATTGTGTCG
GACGAAGTAACGTTCCTCTTGGCAGCGAGTGCTGTTTCGGGGTTACAGCAAGTAGAATTGGGCAGGCAGTTTCATGGTTT
TGTGAGCAAGAACTTTCGAGAGCTACCGATTGTGATAATTAACTCGTTGATGGTGATGTACTCAAGGTGTGGTTTTGTGC
AAAAGTCATTTGGAGTCTTTCATTCGATGAGAGAGAGAGATGTTGTATCTTGGAACACTATGATCTCTGCATTTGTCCAA
AATGGCCTAGATGATGAAGGATTGATGCTGGTTTACGAGATGCAGAAGCAAGGGTTTAAGATTGATTACATAACTGTGAC
AGCTTTGCTTTCGGCTGCATCAAATCTTAGAAACAAAGAGATCGGGAAGCAGACTCATGGTTTCCTTATCAGGCAAGGCA
TTCAGTTTGAGGGAATGAATAGTTACCTTATCGACATGTATGCTAAGTCAGGTCTAATTAGGATATCACAGAAGCTTTTT
GAAGGAAGTGGTTATGCTGAAAGAGATCAAGCTACTTGGAATTCTATGATTTCCGGGTACACGCAGAATGGACACACAGA
GGAAACGTTTCTAGTGTTCAGGAAGATGTTAGAACAGAATATCCGACCTAATGCGGTAACTGTGGCATCAATTCTCCCTG
CTTGTAGCCAAGTAGGTAGTGTTGACTTAGGTAAACAGCTCCATGGTTTCTCTATCAGGCAATACTTGGATCAGAACGTA
TTTGTCGCTTCTGCGTTAGTAGATATGTATTCAAAGGCAGGAGCAATAAAGTATGCAGAAAACATGTTTTCTCAAACAAA
AGAGAGAAACTCCGTGACATACACCACAATGATATTGGGGTATGGTCAACATGGAATGGGCGAGAGAGCCATCTCGCTGT
TTCTCTCAATGCAAGAGTTGGGAATCAAACCCGATGCTATCGCCTTTGTTGCAGTGTTATCAGCTTGCAGCTATTCAGGT
CTAGTGGATGAAGGTCTCAAAATATTCGAGGACATGAGAGAAGTTTATAACATTCAGCCTTCAAGTGAGCACTATTGCTG
CATTACAGACATGTTGGGAAGAGTTGGGCGGGTTAATGAAGCCTACGAGTTTGTTAAAGGACTTGGTGAAGAAGGGAACA
TAGCTGAGCTGTGGGGTTCACTACTCGGGTCTTGTAGACTACACGGTGAGCTTGAGCTTGCTGAAACTGTTTCAGAGAGG
TTAGCTAAATTAGATAAAGGGAAGAACTTTTCCGGGTACGAGGTTTTGCTCTCGAATATGTATGCTGAGGAACAAAATTG
GAAGAGCGTTGATAGAGTGAGGAAAGGAATGAGAGAAAAGGGTTTAAAGAAAGAAGTTGGTCGTAGTGGGATTGAAGTTG
CAGGTCATGTCAACTGTTTTGTGTCTAGAGATCAAGAGCATCCTCACTCTGGTGAGATTTATGATGCAATCGACGGTTTG
GCTAAAAATATGAGAGGCGATTCGTTTCTGACAACATTGCCAATTGTTACTCCAAGTTTGGAATTGGATGAGTGA