Details for Lyrate rockcress Locus 16057174

Position : sca3 ( 5`- 22300765 .. 22299547 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16057174

Protein [Map View]
MGLAKVSCFLFAILFFINGGSSTTFTIVNQCNYTVWPGLLSGAGTTPLPTTGFSLSSSESRLISIPTAWSGRIWGRTLCN
QNENTGKFTCVTGDCGSSQIECSGAGAIPPATLAEFTLNGDGNLDFFDVSLVDGYNVPMTIVPHGGAIGVGKCNATGCAV
DLNGVCPEQLKVTVEAGTAAVACKSACEAFGTPEFCCSGAFGTPDTCKPSEYSGFFKKACPTAYSYAYDDGTSTFTCSGA
DYVITFCPSPSSSEDLKSASPPRLQPDALSVSDASRRISVALSLGVLAVAVSWVGSGL*

DNA
ATGGGTTTGGCTAAAGTCTCTTGCTTTCTCTTTGCGATTCTGTTTTTCATCAATGGTGGTTCCTCCACCACTTTCACCAT
CGTTAACCAGTGTAACTACACCGTCTGGCCTGGACTTCTCTCCGGCGCCGGCACCACTCCATTACCAACCACCGGTTTCT
CCCTCAGCTCGTCCGAGTCACGACTCATCTCCATACCCACCGCTTGGTCCGGCCGCATATGGGGACGCACGCTCTGCAAC
CAAAACGAGAACACCGGAAAATTCACTTGCGTCACCGGCGACTGTGGCTCATCCCAAATCGAATGCTCCGGAGCAGGAGC
AATCCCTCCAGCTACATTAGCCGAGTTCACACTCAACGGCGACGGAAACCTCGATTTCTTCGACGTCAGCCTCGTCGATG
GCTACAACGTCCCAATGACGATCGTCCCTCACGGCGGAGCTATTGGAGTCGGTAAGTGTAACGCAACGGGTTGCGCGGTG
GATCTTAACGGCGTATGTCCGGAACAGCTGAAAGTAACAGTTGAAGCGGGAACGGCTGCTGTAGCGTGCAAGAGCGCTTG
CGAGGCGTTTGGAACGCCGGAGTTTTGTTGTAGTGGCGCGTTTGGAACGCCGGACACGTGTAAGCCGAGTGAGTACTCTG
GTTTCTTCAAGAAAGCTTGTCCGACGGCTTATAGTTACGCTTACGACGACGGTACAAGCACTTTTACTTGCTCCGGTGCT
GATTACGTCATCACTTTCTGTCCTTCTCCTTCCTCAAGTGAAGACTTGAAGAGTGCATCTCCTCCGCGTCTGCAACCGGA
TGCGCTTAGCGTTTCCGACGCGTCGCGAAGAATCTCAGTTGCGTTATCATTGGGCGTTTTGGCTGTTGCGGTTTCTTGGG
TGGGTAGTGGACTTTAG