Details for Lyrate rockcress Locus 16057005

Position : sca3 ( 5`- 7664575 .. 7662957 -3` )
Annotation : [B2G] aldose 1-epimerase family protein
External links : CoGe
PGDD synteny : 16057005

Protein [Map View]
MADQSKNTPQIFELNNGTMQVKISNYGTTITSLSVPDKNGKLADVVLGFDSVDPYVKGLAPYFGCIVGRVANRIKEGKFS
LNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKKDGEKPFITFKYHSADGEEGYPGAVSVTATYTLTSATTMRLDMEA
VPENKDTPISLAQHTYWNLAGHDSGNILDHKIQIWGSHITPVDEYTVPTGEILPVKGTPFDFTEEKRIGESIGEVGIGYD
HNYVLDCPDQEKDGLKHAAKLSNGASSRVLNLWTNVPGMQFYTGNYVNGVVGKGNAVYGKHAGVCLETQGFPNAINQSNF
PSVVVKAGEKYQHTMLFEFSA*

DNA
ATGGCGGATCAGAGCAAGAACACTCCACAGATCTTCGAGCTTAACAATGGCACCATGCAGGTCAAGATCTCAAACTACGG
CACCACCATCACCTCCTTGTCTGTTCCCGACAAGAACGGGAAATTGGCTGATGTAGTTCTCGGATTCGACTCGGTGGATC
CATATGTGAAAGGGCTTGCACCATACTTTGGGTGCATAGTTGGTCGTGTGGCAAATCGGATCAAAGAGGGAAAATTTAGT
CTCAATGGTGTCAACTACACTTTGCCTATCAACAAGCCTCCCAATAGTCTCCACGGTGGTAACAAGGGTTTTGATAAGAA
GATATGGGAAGTTGCAGGGCACAAGAAAGACGGTGAAAAACCTTTTATTACTTTCAAATATCACAGTGCTGATGGGGAAG
AAGGTTACCCTGGTGCGGTTTCTGTCACGGCGACATACACTCTCACGTCAGCCACGACGATGAGACTTGACATGGAAGCT
GTTCCAGAGAACAAAGACACTCCCATCAGCTTAGCTCAGCATACATATTGGAACTTGGCGGGTCATGACTCAGGAAACAT
TCTGGACCATAAGATTCAGATTTGGGGGTCTCATATCACGCCGGTTGACGAATACACAGTTCCTACAGGGGAGATATTGC
CGGTAAAGGGGACGCCTTTCGATTTCACTGAGGAGAAACGGATAGGCGAGTCTATTGGAGAGGTTGGTATTGGATATGAT
CACAACTACGTGTTGGACTGTCCTGATCAAGAGAAGGACGGGCTGAAACACGCCGCGAAGCTCAGCAATGGTGCTAGCTC
AAGGGTACTGAACTTGTGGACCAATGTGCCGGGAATGCAGTTTTATACCGGGAACTATGTGAATGGAGTGGTTGGGAAAG
GGAATGCGGTTTACGGGAAACATGCGGGTGTGTGCCTTGAGACACAGGGATTCCCGAACGCGATTAACCAGTCGAATTTC
CCGTCTGTTGTGGTTAAAGCTGGTGAGAAGTACCAGCACACAATGCTGTTTGAGTTTTCAGCTTGA