Details for Lyrate rockcress Locus 16056992

Position : sca3 ( 5`- 1801675 .. 1800317 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056992

Protein [Map View]
MSDWFLSFEAARAKKLAEEMMRAGDFFGDHKFGTKAQRTCNFFADTFWTRCVNCGHGHTYSRECMNTVMHCSICQKSYLA
CNIGGEPISSTAGEKESQDGETEKRRKTVDDECNKEIKQNAEDYTQLQKKMGEMEKPIDDKLKQHEEFMHDVKPTHVQQP
DSCSDHMKKVQGKITSTVVIAMAENEYLSLLRDETIYHTLVDASRQAAEIQNVTDRWNNMPPALKTIRDAIFDKGRMLFA
REAQQRQRKQELEAKILSIREIEALGIEIAELHQRKGTLTLESSDLEKESEDSQQQLNTLQEQNTKRLHDHLVLMNQLEE
KKTELESLKDQSASTTRKLRRKQKKLDSVVKDVRWIEDQIIEKEEEEREVKEKYERGKTDLTRIKTELDYYKRHSKRIRK
KINDDLLALNKANKSIVDISTQF*

DNA
ATGAGTGATTGGTTCCTTTCGTTTGAGGCTGCGAGGGCGAAAAAGTTAGCAGAGGAAATGATGAGGGCTGGTGATTTTTT
TGGGGATCATAAATTTGGTACCAAGGCGCAAAGAACCTGCAATTTTTTTGCAGACACGTTTTGGACGCGTTGCGTGAACT
GTGGCCATGGGCATACATACTCGAGAGAATGTATGAACACAGTCATGCATTGTTCCATTTGCCAGAAATCTTACCTTGCC
TGCAACATAGGGGGTGAACCTATTAGTTCAACCGCTGGTGAAAAAGAATCTCAAGACGGAGAGACCGAAAAGAGGAGAAA
AACTGTTGATGATGAATGTAATAAGGAGATAAAGCAGAACGCAGAGGATTACACTCAGCTCCAGAAAAAGATGGGTGAAA
TGGAAAAGCCTATAGATGACAAGCTTAAGCAACACGAGGAATTCATGCATGATGTTAAACCCACGCATGTTCAACAGCCT
GATTCCTGCAGTGATCACATGAAGAAGGTCCAAGGGAAGATAACAAGTACAGTCGTTATTGCAATGGCAGAGAACGAATA
TCTCTCTTTGTTGAGAGACGAGACGATATATCACACTCTTGTCGATGCTTCAAGGCAAGCTGCTGAAATCCAGAATGTTA
CTGACAGATGGAACAATATGCCACCTGCGTTGAAGACAATTCGAGACGCCATATTTGATAAAGGTCGGATGTTATTTGCG
AGAGAAGCGCAACAACGACAGAGAAAGCAAGAACTTGAAGCGAAGATTCTTTCAATACGTGAAATTGAAGCCCTAGGGAT
AGAGATTGCAGAACTTCATCAACGCAAGGGGACTCTCACTTTAGAGTCATCGGATTTGGAAAAAGAATCTGAGGATTCTC
AGCAGCAATTAAACACACTTCAGGAACAGAATACGAAAAGACTACACGATCACTTAGTTTTAATGAACCAGCTTGAGGAA
AAGAAGACTGAGTTGGAATCGCTAAAGGATCAGTCGGCGTCTACTACACGAAAATTGCGTAGGAAACAAAAGAAACTCGA
CTCTGTTGTTAAAGATGTGAGGTGGATAGAGGATCAAATCATCGAAAAAGAGGAGGAGGAAAGGGAAGTTAAAGAAAAGT
ATGAACGAGGAAAAACTGACCTGACCCGAATAAAAACAGAGCTGGATTACTATAAGCGGCACTCAAAAAGGATACGGAAG
AAAATCAATGACGACCTCCTTGCACTCAACAAGGCGAACAAGTCGATCGTCGATATTTCTACACAATTCTGA