Details for Lyrate rockcress Locus 16056985

Position : sca3 ( 5`- 12293697 .. 12294422 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_319189 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056985

Protein [Map View]
MGKYIKKSKVAGAVSVKDISHPTTLRFRTRSPAAKNLALYRLRSHSNEADSLNYLQLRSRRLMKLPLLANTRKQLTQCVN
QCQTRNPRAKSGPAKKSEAETTTMEEACGDNERISRSDCNFGDKGFDLESENRSMIRDSKAIQSEIEDFFANAEEQQQRF
FIQKYNFDIVSDNPLPGRYEWV*

DNA
ATGGGAAAATACATTAAGAAGTCAAAAGTCGCCGGAGCCGTTTCCGTTAAGGATATCTCTCACCCAACCACTCTCCGTTT
CCGTACCAGATCCCCCGCTGCCAAAAACCTCGCCCTCTACCGTCTCCGTTCTCATTCCAACGAAGCAGACTCTTTAAACT
ACCTCCAGCTCCGGAGCCGCCGTCTCATGAAGCTTCCATTACTCGCCAATACTAGGAAACAGCTCACACAGTGTGTCAAT
CAATGTCAAACGAGAAACCCTAGGGCTAAATCCGGTCCGGCGAAGAAATCAGAAGCGGAGACGACGACGATGGAAGAAGC
TTGTGGTGATAATGAGAGAATATCTAGGTCTGATTGTAATTTTGGAGATAAAGGTTTTGATTTGGAATCAGAAAACAGGA
GCATGATAAGAGACTCAAAAGCTATACAAAGTGAGATTGAAGACTTCTTTGCTAACGCAGAGGAGCAACAACAGAGATTC
TTCATTCAAAAGTACAACTTTGACATTGTCTCGGACAATCCATTGCCTGGACGTTACGAATGGGTCTGA