Details for Lyrate rockcress Locus 16056942

Position : sca3 ( 5`- 4123136 .. 4126060 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897210 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056942

Protein [Map View]
MELCNQNNHITGDPLNWNATADALKGSHLDEVKRMVEDYRKGAVKLGGETLTIGQVAAVARGGEGGATVELAEEARAGVK
ASSEWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQNELIRFLNAGIFGTGAGDTSHTLPKPTTRAAMLVRVNTLLQG
YSGIRFEILEAITKLLNHEITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPFGETLTASEAFKLAGVSSFFELQ
PKEGLALVNGTAVGSGLASTVLFDANILAVLSEVMSAMFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYV
KEAQLIHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRAATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVAMDN
SRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVN
SLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKKAIKSAVSQVAKRVLTVGVNGELHPSRFTERDVLQVVD
REYVFSYADDPCSLTYPLMQKLRHILVDHALADPEREANSATSVFQKIGAFESELKLLLPKEVERVRVEYEEGTSAIANR
IKECRSYPLYRFVRNELDTELLTGENVRSPGEEFDKVFSAISDGKLIDPLLECLKEWNGAPIPIC*

DNA
ATGGAGCTATGCAATCAAAACAACCACATCACCGGCGATCCGTTGAACTGGAACGCGACGGCGGACGCTTTGAAAGGGAG
CCACTTGGACGAGGTGAAACGAATGGTGGAAGATTATAGGAAAGGGGCGGTGAAGTTAGGAGGTGAGACGTTGACGATTG
GTCAAGTCGCCGCCGTCGCTAGAGGAGGAGAAGGAGGAGCTACGGTGGAGTTAGCGGAGGAGGCTCGTGCCGGAGTCAAG
GCGAGTAGCGAATGGGTGATGGAGAGCATGAACCGAGGAACCGACAGCTATGGAGTCACCACAGGTTTTGGTGCTACTTC
CCATAGAAGAACTAAACAAGGCGGTGCACTTCAAAATGAGCTTATTAGGTTCTTGAACGCCGGAATATTTGGCACTGGCG
CCGGAGACACGTCACACACGTTGCCAAAGCCGACGACAAGAGCGGCAATGCTCGTCCGTGTCAACACTCTCCTCCAAGGC
TACTCCGGTATACGCTTCGAGATTCTCGAAGCCATTACAAAGCTTCTCAACCACGAAATCACTCCGTGCCTCCCTCTTCG
TGGCACCATCACGGCCTCCGGTGACCTTGTCCCTCTCTCTTACATCGCCGGACTCCTCACCGGCCGTCCCAACTCCAAAG
CCGTGGGTCCCTTCGGTGAGACTCTCACTGCCTCTGAGGCCTTTAAGCTCGCGGGAGTATCGTCTTTTTTCGAGCTTCAG
CCTAAGGAAGGACTAGCACTTGTGAACGGGACAGCGGTTGGATCGGGTTTGGCCTCGACGGTTCTGTTCGATGCAAATAT
TTTGGCTGTTTTGTCGGAGGTTATGTCTGCCATGTTCGCAGAGGTTATGCAAGGGAAACCGGAGTTTACCGACCATCTTA
CGCATAAACTCAAGCACCATCCCGGTCAGATCGAAGCAGCCGCGATTATGGAACATATATTGGACGGAAGCTCTTACGTT
AAAGAAGCTCAACTTATCCACGAAATGGATCCTCTTCAAAAACCTAAACAAGATCGGTACGCTTTACGTACGTCGCCTCA
ATGGCTTGGCCCGCAGATTGAAGTGATCAGAGCGGCCACTAAAATGATTGAGCGTGAGATCAACTCGGTTAACGATAACC
CTTTGATAGATGTGTCGAGGAACAAGGCTTTGCACGGCGGGAATTTCCAAGGGACACCGATTGGTGTCGCCATGGATAAT
TCTCGTCTAGCCATTGCTGCGATTGGGAAACTCATGTTCGCCCAGTTTTCTGAACTAGTGAACGATTTCTACAACAATGG
TTTGCCTTCTAATCTATCCGGTGGGAGAAACCCTAGTCTTGATTACGGATTTAAAGGCGCGGAAATAGCTATGGCTTCTT
ATTGCTCCGAGCTCCAGTTCTTGGCTAATCCCGTGACCAACCATGTCCAAAGCGCAGAGCAGCATAACCAAGATGTTAAT
TCCCTAGGGCTGATCTCGAGCCGGAAAACCGCAGAAGCAGTCGATATCCTCAAGCTAATGTCCACGACCTATTTAGTCGC
GCTGTGCCAAGCCATTGATCTAAGACATCTTGAAGAGAATCTGAAGAAAGCAATTAAATCTGCAGTGAGTCAGGTGGCGA
AACGGGTCTTAACCGTTGGGGTCAATGGTGAGCTACATCCTTCGAGGTTCACTGAACGCGATGTTCTCCAAGTGGTTGAC
CGAGAGTATGTGTTCTCATACGCAGACGATCCCTGCAGCCTCACTTACCCGTTAATGCAGAAACTTAGACACATTCTTGT
AGATCACGCTTTAGCGGATCCAGAACGCGAGGCCAATTCCGCGACATCAGTTTTCCAGAAAATCGGAGCCTTTGAGTCCG
AGTTGAAACTGCTTCTCCCTAAAGAAGTGGAACGTGTCCGGGTTGAGTACGAGGAAGGAACCTCGGCTATAGCTAACCGG
ATTAAGGAATGTCGGTCTTATCCGCTGTACCGGTTTGTCCGCAACGAGCTAGATACTGAACTGCTCACTGGAGAGAATGT
TCGGTCGCCGGGAGAGGAGTTCGATAAAGTGTTCTCGGCGATTTCTGATGGAAAGCTTATTGATCCGTTGCTGGAATGTC
TCAAGGAGTGGAACGGAGCTCCGATTCCGATCTGTTAA