Details for Lyrate rockcress Locus 16056910

Position : sca3 ( 5`- 6737346 .. 6740379 -3` )
Annotation : [B2G] CES101 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056910

Protein [Map View]
MWSNGIFLIFFTLSLLLGQSCCETDTLLQGQYLKDGQELVSAFNIFKLKFFNLENSSNWYLGIWYNNFYLSGNKKYGDIQ
DKAVWIANRNNPILGRSGSLTVDSLGRLRILRGASSLLEISSTETTGNTTLKLLDSGNLQLQEMDSDGSMRQILWQSFDY
PTDTLLPGMKLGFNVKNGKRWELTSWLGDTLPASGSLVFGMDANITNRLTILWRGNMYWASGLWFKGGFSLEVLNEYGFL
FSFISTESEHYFMYSDDHKFAGTFFPAIMIDQQGILHIYRLDRERLHTSLLYGLFARWYSFRETVSAFSSNGFILNETGG
RFSSADCHAICMQNSSCIAYASTNLDGTGCEIWNIDPTDKKSSSQQIYVKPRARKGGNLASCCGITIPNYTCDLVKICIR
ITQMLPSQLCSLTNKFTTFCVFLIQRLPTLRVGSTIDQEMLLPSSDANKLGEGGFGPVYKGSLIDGEEVAIKRLSLASGQ
GLVEFKNEAMLIAKLQHTNLVQLLGCCIEKDEKMLVYEYMPNKSLDYFLFDPLRKNILDWTLRFRIMEGIIQGLLYLHKY
SRLKVIHRDIKASNILLDEDMNPKISDFGMARIFGAQESRANTKRVAGTFGYMSPEYFREGLFSAKSDVFSFGVLMLEII
CGRKNNSFHHDSEGPLNLIVHVWSLFKENRVHEVIDPSLGDSAVENPQVLRCVQVALLCVQQNAEDRPSMLEVVSMIYGD
GNNALSLPNEPAFYDGPRRSSPEMEVEPPELENVSANRVTITVMEAR*

DNA
ATGTGGTCAAATGGCATCTTTCTCATTTTTTTTACTTTGTCTCTCTTGTTAGGACAATCATGTTGTGAAACAGATACGCT
ACTGCAGGGTCAGTACTTGAAAGATGGGCAAGAGCTCGTTTCAGCTTTCAATATCTTCAAACTCAAGTTTTTCAACTTGG
AGAATTCAAGCAACTGGTATCTTGGAATTTGGTACAACAATTTTTATCTTAGTGGTAATAAGAAGTATGGTGATATCCAG
GATAAAGCTGTTTGGATTGCTAACCGTAACAATCCAATTTTGGGACGCTCTGGAAGCCTCACAGTGGATTCTCTTGGCCG
ATTGAGGATTTTAAGGGGAGCATCAAGCCTGCTTGAGATAAGCTCTACGGAAACCACAGGAAACACAACCCTTAAGCTGT
TGGATTCTGGAAATCTTCAGCTCCAAGAGATGGATTCTGATGGATCGATGAGGCAGATTCTGTGGCAAAGTTTTGATTAT
CCAACGGATACCCTTCTTCCTGGTATGAAACTTGGTTTCAATGTTAAGAATGGGAAGAGATGGGAACTGACATCATGGCT
AGGTGATACTTTACCTGCTTCTGGATCTCTTGTCTTTGGGATGGATGCTAATATTACAAACCGGTTGACCATCTTGTGGC
GTGGAAACATGTATTGGGCAAGTGGGCTCTGGTTTAAGGGTGGGTTTTCCTTGGAGGTATTAAATGAATATGGTTTCCTC
TTTTCCTTCATTTCAACCGAGAGTGAACACTATTTTATGTATTCAGATGATCACAAATTTGCTGGAACATTTTTTCCCGC
GATAATGATAGACCAACAGGGAATTTTGCATATATACAGGCTTGACAGAGAGCGTTTGCATACATCATTGTTATATGGAT
TGTTTGCACGCTGGTATTCTTTTAGAGAGACAGTATCGGCTTTCTCAAGCAATGGATTTATACTTAATGAGACTGGTGGA
AGGTTTAGTTCAGCTGATTGCCATGCTATATGTATGCAAAACTCTTCTTGTATTGCCTATGCTTCTACCAATCTGGATGG
TACGGGCTGCGAAATCTGGAATATTGATCCTACCGACAAAAAGTCGTCTTCTCAACAAATCTATGTTAAACCAAGGGCAC
GAAAAGGCGGCAACTTGGCTAGTTGTTGTGGCATCACTATTCCTAATTATACCTGTGACTTGGTAAAAATTTGTATCAGA
ATCACTCAAATGCTTCCTTCTCAATTGTGCTCTCTTACTAATAAATTCACCACTTTTTGTGTATTTTTGATCCAGAGGCT
TCCAACACTGAGGGTTGGTTCAACAATAGACCAAGAAATGCTACTACCCTCCTCTGATGCAAACAAGCTCGGTGAAGGAG
GTTTTGGTCCTGTATATAAGGGGAGTTTAATAGATGGGGAAGAGGTGGCTATCAAAAGACTATCATTAGCATCCGGGCAA
GGATTAGTGGAGTTCAAGAACGAAGCAATGCTTATTGCAAAACTTCAACACACAAATCTTGTTCAGTTGCTAGGATGCTG
CATCGAAAAGGATGAGAAAATGTTGGTTTACGAATACATGCCCAACAAGAGCCTTGACTACTTCCTCTTTGATCCCTTGA
GGAAAAACATTTTGGATTGGACACTGCGGTTCAGGATCATGGAAGGGATAATTCAAGGGCTTTTGTACCTTCACAAGTAC
TCGAGATTGAAAGTGATACACAGAGACATCAAAGCCAGCAACATTTTACTGGACGAGGATATGAATCCCAAAATATCCGA
TTTTGGAATGGCTCGGATATTTGGAGCGCAAGAATCCAGAGCTAACACCAAAAGAGTTGCTGGCACATTTGGATATATGT
CTCCGGAGTACTTCAGAGAAGGACTGTTCTCGGCGAAATCAGATGTATTTAGCTTCGGAGTTCTAATGTTGGAAATCATT
TGTGGAAGGAAGAACAATAGCTTCCACCATGACTCAGAAGGACCTCTGAATCTCATAGTTCATGTGTGGAGTCTGTTTAA
AGAGAACCGAGTTCACGAGGTGATAGATCCGTCTTTGGGAGATTCTGCAGTTGAGAACCCTCAAGTGTTGAGATGTGTTC
AAGTTGCTCTGTTGTGTGTACAACAAAACGCAGAAGATAGACCAAGTATGTTAGAAGTTGTGTCGATGATATACGGCGAC
GGCAACAACGCTCTTTCTTTGCCTAACGAGCCAGCTTTCTATGATGGTCCTCGGAGAAGCTCTCCGGAGATGGAGGTTGA
ACCACCTGAGCTGGAAAATGTATCGGCAAATAGAGTTACCATCACAGTGATGGAAGCAAGATGA