Details for Lyrate rockcress Locus 16056904

Position : sca3 ( 5`- 3626213 .. 3627415 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056904

Protein [Map View]
MSKQIADEIGSLSLVTGCKIKNEDLTEEKSLMVKPTMGRTWHWSPIEGLHSQDSIRHTHAYILQEIARMTIYPEAGVSHT
LRHKKGIVIGVARAVSTELYHIVDNDLIMEEMDTAKLATEYDRKTIVIKNDVDSKWKEELSKPLKLSETENKVIQRLLLI
AHGVIPLQGYSLVTTSHHYNDQSKRAFSMVERQFFSRFDQFSWWKEDEEALRDAMWHKAGHPVKISFKKEIACSNTIKQS
LINAGIQSAAFRLPATEDAVMKAGAYRKLLKTLSPIFDDEVKWEALDEMLSYLDNFSAARPTEVVTVHNAPTHLLSMDTR
EKVVVWIAQWCSQNAEKVAICLGFHTAMSEKAGKFVWPSHSLSVLKRTNVDSCILGRKLFSDYTVFKAKLRQIMDFASVP
*

DNA
ATGTCGAAACAGATAGCTGATGAGATTGGTTCTCTTTCCCTCGTCACTGGCTGCAAAATCAAGAATGAGGATTTAACTGA
AGAGAAGAGCTTAATGGTGAAGCCAACCATGGGCAGGACCTGGCACTGGTCTCCAATAGAGGGTCTTCACTCACAGGATT
CAATCAGGCATACTCATGCCTATATATTGCAAGAGATTGCAAGGATGACCATCTATCCCGAGGCCGGTGTCAGCCATACC
TTGAGACACAAGAAGGGTATTGTCATTGGGGTGGCGAGAGCCGTGTCCACTGAGCTGTATCACATTGTTGACAATGACCT
CATAATGGAGGAGATGGACACAGCGAAATTGGCAACGGAATACGATAGGAAAACCATAGTGATCAAAAACGACGTGGACT
CAAAGTGGAAGGAGGAGCTGTCCAAACCTTTGAAATTGTCTGAAACCGAAAATAAAGTGATTCAAAGACTGCTCTTAATC
GCTCATGGAGTGATTCCCCTCCAGGGGTACTCATTGGTCACGACTTCCCACCATTACAATGACCAGTCGAAGAGAGCATT
TTCCATGGTGGAGAGGCAATTCTTTTCTCGCTTTGACCAATTCTCTTGGTGGAAAGAGGATGAAGAGGCCTTAAGGGACG
CCATGTGGCACAAGGCTGGACACCCAGTGAAGATATCTTTCAAGAAGGAGATTGCATGCAGTAATACCATTAAGCAGAGT
CTAATTAACGCAGGTATTCAGAGCGCTGCATTTAGGCTCCCTGCTACTGAAGACGCCGTTATGAAGGCTGGAGCCTACAG
GAAACTTTTAAAAACTTTGTCACCTATCTTCGATGATGAGGTCAAGTGGGAGGCTCTTGATGAGATGCTATCATATCTGG
ATAATTTTTCAGCTGCTAGGCCAACAGAGGTAGTTACCGTTCACAACGCGCCTACTCACCTCCTGAGCATGGACACGAGG
GAGAAGGTGGTGGTTTGGATTGCACAATGGTGCTCTCAGAACGCTGAAAAAGTAGCTATTTGTTTAGGGTTTCACACGGC
CATGTCTGAAAAGGCTGGAAAGTTTGTCTGGCCCTCCCACTCGCTCTCTGTACTCAAGAGAACCAATGTTGACTCCTGCA
TCTTAGGGAGAAAACTTTTCTCTGATTACACTGTCTTCAAGGCCAAGCTTCGTCAAATCATGGACTTTGCGAGTGTCCCA
TAG