Details for Lyrate rockcress Locus 16056873

Position : sca3 ( 5`- 5113670 .. 5111472 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056873

Protein [Map View]
MASAAASPAFSLLKSTGGVASSAGTRARASLLPVPSTSVSARPLGFSATLDSRRFTLHVASKVESVRGKGSRGVVSMAKK
SVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLGRPKGVTPKFSLAPLVPRLS
ELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTK
FLKPSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEE
DKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMG
VFEMEKFAAGTEAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPVT
V*

DNA
ATGGCTTCCGCTGCCGCAAGTCCCGCCTTTTCACTCCTTAAGTCCACCGGCGGCGTCGCTTCCTCCGCCGGAACTCGCGC
ACGCGCCTCCCTTTTACCAGTTCCCTCTACCTCTGTCTCCGCGCGTCCACTTGGCTTCTCCGCCACTCTCGATTCCCGTC
GTTTCACTCTCCACGTTGCTTCCAAAGTTGAATCGGTGCGCGGGAAGGGAAGCAGAGGAGTGGTTTCTATGGCGAAGAAG
AGCGTCGGAGATCTGACCTCAGCTGATTTGAAGGGGAAGAAGGTTTTCGTGAGAGCTGATCTCAATGTACCTCTCGATGA
TAACCAGACTATCACTGACGATACCAGAATCCGTGCCGCTATTCCAACGATCAAGTATTTGATCGACAATGGTGCTAAAG
TTATCCTCTCCACTCATCTGGGAAGGCCAAAGGGAGTCACACCAAAGTTTAGTTTGGCTCCTCTTGTCCCTAGGCTCTCC
GAGCTTCTTGGTATTGAGGTTACGAAAGCTGATGATTGTATCGGTCCAGAAGTAGAAAGCTTGGTGGCTTCTCTTCCTGA
AGGTGGAGTTTTGCTTCTTGAGAATGTCAGGTTTTACAAGGAGGAAGAGAAGAACGATCCTGAGTTTGCTAAGAAGCTTG
CTTCTCTAGCTGACCTTTATGTCAATGATGCTTTCGGAACTGCTCACAGAGCTCATGCTTCTACCGAAGGAGTCACTAAG
TTCTTGAAGCCTTCAGTTGCTGGTTTCCTTCTGCAAAAGGAGCTGGACTATCTTGTTGGCGCTGTTTCAAACCCAAAGAG
ACCATTTGCAGCCATAGTGGGTGGTTCCAAGGTCTCATCAAAGATTGGAGTTATTGAATCGCTTCTGGAGAAATGTGATA
TCCTTCTTCTTGGTGGTGGAATGATCTTTACATTCTACAAGGCACAAGGTCTTTCAGTTGGTTCGTCCCTTGTTGAAGAA
GACAAACTTGAATTGGCTACAGAACTCCTTGCCAAAGCTAAGGCCAAAGGAGTCTCTCTTTTGTTGCCAACAGATGTTGT
GGTTGCTGACAAGTTTGCTCCTGATGCCAACAGCAAGATTGTGCCTGCATCAGGCATTGAGGACGGATGGATGGGATTGG
ACATCGGTCCAGACTCTATCAAAACTTTCAACGAAGCTCTGGACACAACACAAACAGTTATTTGGAATGGACCTATGGGA
GTTTTCGAGATGGAAAAGTTTGCGGCAGGAACAGAGGCGGTAGCGAATAAACTAGCAGAGCTAAGTGGTAAAGGAGTGAC
AACGATAATAGGAGGAGGAGACTCGGTGGCTGCAGTGGAGAAAGTAGGAGTAGCAGGAGTCATGAGTCACATCTCCACTG
GTGGTGGAGCCAGCTTGGAGCTGTTGGAAGGCAAAGTACTTCCCGGTGTGATCGCCCTTGATGAAGCGATCCCAGTCACC
GTTTAG