Details for Lyrate rockcress Locus 16056865

Position : sca3 ( 5`- 12732469 .. 12733608 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056865

Protein [Map View]
MSATLRRLILLSSANRSINSSPSYLSSTVNHLSLSFSSVSSSPESHTSPPRIRTRTPLETQFETWIQNLKPGFTNSDVVT
ALRAQSDPDLALDIFRWTSQQRGYKHNHEAYHTMIKQAITGKRNKFVETLIEEVIAGACEMSVPLYNCIIRFCCGRKFLF
NRAFDVYNKMLRSEDSKPDLETYTLLLSSLLKRFNKLNVCYVYLHAVRSLTKQMKSSGVIPDTFVLNMIIKAYAKCLEVD
EAIRVYKEMALYGSEPNAYTYSYLIKGVCEKGRLGQGLGFYKEMRSKGMVPNGSCYMVLICSLSMERRLNEAVEVVYDML
ANSLSPDMLTYNTVLTELCRGGRGGEALELVEEWKKRDPVMGERNYRTLMDEVYFLNKG*

DNA
ATGTCGGCGACACTCCGACGCCTCATCCTTCTCTCCTCCGCTAATCGCTCCATTAATTCATCTCCGTCGTACCTTTCCTC
CACCGTGAATCACTTATCTCTATCATTCTCTTCCGTCTCATCTTCACCGGAATCACACACTTCCCCTCCCCGGATTCGAA
CCCGAACTCCACTCGAAACTCAATTCGAAACATGGATCCAGAATCTAAAACCAGGATTCACAAACTCCGATGTTGTAACA
GCGTTACGAGCTCAATCAGATCCAGATCTAGCTCTCGACATTTTCCGATGGACATCTCAACAACGAGGCTACAAACACAA
TCACGAAGCTTACCACACTATGATCAAACAAGCAATCACCGGAAAACGAAACAAATTCGTCGAAACGTTAATCGAAGAAG
TAATCGCCGGAGCTTGTGAAATGAGTGTTCCTCTCTACAATTGCATCATCAGATTCTGTTGTGGTCGTAAGTTTCTCTTT
AATCGAGCTTTTGATGTTTATAACAAAATGCTTCGATCAGAAGATTCAAAGCCTGATCTTGAAACCTATACTTTGCTTCT
AAGCTCATTGCTTAAGAGATTCAACAAATTGAATGTGTGTTATGTGTATCTACATGCCGTTAGATCGCTTACGAAGCAGA
TGAAATCGAGCGGTGTGATACCGGATACGTTTGTGTTGAATATGATTATCAAAGCTTATGCAAAGTGTCTTGAGGTAGAT
GAAGCTATAAGGGTTTATAAAGAGATGGCTTTGTATGGTTCTGAGCCTAATGCTTATACTTATAGTTACTTGATTAAAGG
GGTTTGTGAGAAAGGAAGGCTTGGACAGGGTTTAGGGTTTTATAAGGAGATGAGAAGCAAAGGGATGGTTCCGAATGGGA
GTTGTTATATGGTTTTGATTTGTAGTTTGTCTATGGAGAGGAGGTTGAATGAAGCGGTTGAGGTTGTGTATGATATGTTG
GCGAATTCGTTGTCTCCGGATATGTTGACTTATAATACGGTTTTGACGGAGTTGTGTAGGGGAGGTAGAGGGGGTGAAGC
TCTTGAGTTGGTTGAGGAATGGAAGAAACGGGATCCGGTGATGGGTGAAAGGAATTACAGAACGTTGATGGATGAAGTTT
ATTTTTTGAATAAGGGATGA