Details for Lyrate rockcress Locus 16056853

Position : sca3 ( 5`- 11949730 .. 11952543 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479968 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056853

Protein [Map View]
MARGLSLCSNGRKSSTLLSNSILRVSFSFSPKTLFTSSYPHQSRHPKFSRLFCNHACVPETVDETKYKELFNKRMAMAGL
KPHHRIALGVSGGPDSMALCVLTAKWKTEGLSCVNKSDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC
DWVDGRPKLGHLQEAAREMRYQMISNVCFRHQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDA
KHIKNRSILLVRPLLDLWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGNLHSGNFKSELHAVISECRRTRSFVD
KFCTDLISQTVTVTDKGYAILDLERLNPTEVKDICLSKYLAAVLQFISQRHRPVRGNTSKLLLNYIRAIPCRTSLTAAGC
YLSPAPGSKGTKIIVSCSVDCPLPSKTELVNICVNEAQKKPTSDDLSKIISDATSISDHEAPSKLFEVHFLVVASESVLS
KARELNLLSESTYTTIGLLQRNETNRFITTTEDKSVDESEHGTNIASSSDNVLLLPGQNLYFMNRFLIRWNLSDHQCDEA
GCGNCPVRTATSMEVRHMVESDWLYLAELSKCSNSNHSMSSSQKALRSLKLIPAAARKSLPVLINHCGLLLSVPAISFNY
CPCLEASAVFLPRVPLGGGHSSFL*

DNA
ATGGCGCGAGGTCTGTCTCTCTGCTCCAATGGAAGAAAGTCTTCGACTTTACTCTCAAACTCCATCCTTAGGGTTTCATT
TTCCTTTTCTCCGAAAACCCTTTTCACGTCTTCATATCCACATCAATCTCGCCACCCAAAATTCTCACGATTGTTCTGTA
ACCACGCATGTGTTCCCGAGACGGTGGACGAAACGAAGTATAAGGAGCTTTTCAATAAAAGAATGGCTATGGCAGGACTT
AAACCTCACCACCGAATTGCTTTGGGAGTTTCAGGTGGTCCTGATAGTATGGCTCTTTGTGTTCTAACTGCAAAATGGAA
AACTGAAGGATTAAGTTGTGTTAATAAGTCAGATGGTTTCATTGATGGACTTGTTGCTATAGTTGTGGATCATGGATTAA
GACAAGAGAGTAAAGATGAAGCTGAACTTGTCTGTTCTAGAGTTTCTCAAATGGGTATTAGATGTGAGATTGCAAGTTGT
GATTGGGTTGATGGTAGACCAAAGCTTGGTCACTTGCAAGAAGCAGCTCGTGAAATGAGGTATCAAATGATTTCGAATGT
TTGTTTTCGACATCAGATTGAGGTCTTACTTATAGCTCATCATGCCGATGACCAGGCTGAGTTATTCATTCTCAGGTTAT
CTCGTAGTAGCGGTGTACTTGGGCTTGCGGGTACAGCTTTTGCTTCCGAGATTTTCTCCAGAAATCTGCAGTTAGATGCA
AAACATATAAAGAACCGATCTATTCTCTTAGTGCGTCCGCTACTAGATTTATGGAAAGAAGACATGTATAAGATATGTCA
ATGGGGTAGACAAGATTGGGTTGAAGATCCGACTAATCGTAGTCAATTGTTTGTCCGGAACAGGATTCGAACGTCAATAG
GAAATCTACATTCAGGCAACTTCAAGTCAGAGCTTCATGCAGTCATTTCTGAATGCCGAAGAACACGTTCATTTGTTGAT
AAATTTTGTACAGACTTAATAAGTCAGACCGTAACAGTGACAGATAAAGGGTATGCTATTCTTGATCTAGAGAGACTAAA
TCCTACAGAAGTTAAAGACATTTGCCTCTCAAAGTATCTCGCTGCAGTCTTGCAGTTTATCTCTCAACGGCACAGACCAG
TCAGAGGAAACACTTCAAAGTTGCTTTTGAACTATATCCGCGCAATTCCGTGCAGGACATCTCTAACAGCTGCTGGTTGC
TACCTTAGTCCAGCTCCTGGGTCCAAGGGTACCAAAATTATAGTTTCTTGTTCTGTTGACTGTCCTTTACCATCAAAGAC
AGAACTCGTGAACATTTGCGTCAATGAAGCTCAGAAAAAACCGACTTCTGATGACCTCAGTAAAATCATATCAGACGCAA
CATCTATTTCAGACCATGAGGCCCCGAGCAAATTGTTTGAAGTCCATTTTTTGGTTGTTGCATCTGAATCCGTATTGAGT
AAAGCCAGAGAGCTCAATCTTCTCAGCGAATCGACCTATACAACCATTGGTCTACTGCAAAGGAATGAAACCAATCGGTT
CATAACTACAACAGAAGACAAATCTGTAGATGAATCTGAGCATGGAACCAACATTGCATCTTCCTCTGATAATGTACTTC
TTTTGCCAGGGCAAAATCTCTACTTCATGAACCGGTTTCTCATCAGATGGAACTTGAGTGACCACCAATGTGATGAAGCT
GGCTGCGGAAATTGTCCAGTGAGGACAGCTACATCAATGGAGGTTCGGCACATGGTTGAATCCGACTGGCTATATCTAGC
TGAGCTTTCAAAATGCTCGAACTCAAACCATTCTATGTCATCCTCACAAAAAGCTCTCAGGTCCTTAAAGTTGATCCCAG
CTGCTGCAAGAAAAAGCCTCCCGGTCTTGATCAATCATTGCGGACTACTACTCAGTGTTCCCGCTATTAGCTTCAACTAT
TGTCCATGCCTTGAGGCATCTGCAGTGTTTCTTCCAAGAGTACCACTCGGAGGCGGTCATAGCTCATTTCTCTAG