Details for Lyrate rockcress Locus 16056834

Position : sca3 ( 5`- 9799171 .. 9797983 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056834

Protein [Map View]
MAQIRKSEFVSLPDKNPCPWDQYHLILKTIQRSRFNQYNTLKPPDEGRATNSRQKHITESSSFLVSPPSLHHPITKRHSE
KMETEFDSLTELPPLPPSDFTPSSFTFSDHQLDLSLSHADSLFLDSTLSLLNRHHLTESTRLEHLFYDSTQLFQNDLATT
TTPFLHLPNLTSIEQPPAVEEEPTTMKLFPSLSPPLPLPDAKRRKKLNSYSSSTNSGSPTASSSNTNDGGTGITKRKKIS
DKIRSLEKLMPWENKMSLAMILEESHRYIKFLQSQIASLSWMPLESVYNTAGEVGESDLLKSLTRQQILQVIANSPGSRN
VLSSHGVCLFSYEQLLSLKTMSRNF*

DNA
ATGGCACAAATCCGTAAATCAGAATTTGTTTCGCTACCTGACAAAAATCCCTGTCCATGGGATCAGTATCATCTGATCTT
AAAAACAATCCAACGGTCCAGATTCAATCAGTACAATACCCTGAAACCGCCTGACGAGGGTCGCGCGACAAACAGTCGAC
AAAAACATATAACGGAATCGTCTTCGTTCCTCGTGTCGCCGCCTTCTCTACACCACCCAATCACAAAACGCCACTCGGAG
AAAATGGAGACTGAGTTTGACTCGCTCACTGAGTTACCACCGCTTCCACCTTCCGACTTCACTCCCTCTTCCTTCACCTT
CTCCGACCACCAACTCGACTTGTCTCTCTCTCATGCTGACTCGCTCTTTCTCGACTCAACACTGTCTCTCCTCAATCGTC
ACCACCTCACTGAGTCAACTCGCCTCGAACATCTCTTTTACGACTCCACTCAGCTCTTTCAAAACGACCTCGCCACCACC
ACAACACCGTTTCTTCACTTACCAAATCTCACATCCATCGAACAACCACCCGCCGTGGAAGAAGAACCGACGACGATGAA
GCTCTTTCCATCTCTCTCTCCTCCTCTTCCTCTTCCCGACGCTAAACGTCGCAAGAAGCTTAACTCGTATTCCTCTTCAA
CAAACTCCGGATCTCCAACAGCGTCATCATCAAACACAAACGACGGTGGTACTGGTATTACCAAACGAAAGAAGATCTCT
GACAAAATCAGATCCTTGGAGAAACTTATGCCATGGGAAAACAAAATGAGTTTAGCGATGATTCTAGAAGAATCTCACAG
ATACATCAAGTTTCTTCAATCTCAAATTGCTTCACTCAGTTGGATGCCTCTTGAATCTGTCTACAACACCGCCGGAGAAG
TAGGAGAATCCGATTTGCTCAAATCGCTAACACGTCAACAGATTCTTCAAGTTATTGCGAATTCTCCAGGTTCACGAAAC
GTACTTTCCTCTCATGGTGTTTGTCTCTTCTCTTACGAACAGCTTCTTTCTCTCAAGACAATGTCGAGAAACTTCTGA