Details for Lyrate rockcress Locus 16056830

Position : sca3 ( 5`- 9766307 .. 9767649 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056830

Protein [Map View]
MLSIFGSVHILAVVAIQLLIIPSVSSLNLTNAYLHHKCNNTEGKYSYGSAFEKYINLALRAMDSDNFLNGFGFIERGEDP
NKVFVMYQCRGDSYGSKCQSCISAAVSGIDYENDFYLSNPKNVNDKELFNKETSALLVELTNKATDKNNMVGNQFVLYAA
GEKRIGTKNVYAMVQCTKDLVTTTCAACFEWIFKMFSKCCDGKRGGRVLGTSCNFRYELYPFLRN*

DNA
ATGCTTTCAATATTTGGATCGGTCCATATCTTGGCTGTGGTGGCCATACAACTCCTAATTATACCAAGTGTTTCATCCCT
TAACCTTACAAATGCGTATTTGCACCACAAATGTAACAACACCGAAGGAAAATATAGCTACGGGAGTGCGTTTGAGAAAT
ATATCAACTTAGCTCTCCGTGCCATGGATTCAGACAATTTTCTCAATGGTTTCGGCTTTATTGAGAGAGGTGAGGATCCC
AATAAAGTCTTCGTCATGTACCAATGTCGCGGTGACTCCTACGGGTCTAAGTGCCAATCCTGCATAAGCGCTGCCGTCTC
AGGGATTGATTACGAGAACGATTTCTATTTGTCAAACCCGAAAAACGTGAATGATAAGGAGTTGTTCAACAAAGAGACGT
CGGCTCTCTTGGTGGAGCTAACAAATAAAGCCACCGATAAAAATAACATGGTAGGGAATCAATTTGTGCTGTACGCGGCG
GGGGAAAAGAGAATTGGAACGAAGAATGTGTATGCAATGGTGCAGTGTACGAAAGACTTAGTGACTACAACTTGCGCTGC
GTGTTTCGAATGGATTTTCAAGATGTTTTCAAAGTGCTGTGATGGAAAGCGAGGAGGGAGAGTTTTGGGTACGAGCTGTA
ACTTTAGGTATGAGTTATATCCCTTTCTTAGAAATTAA