Details for Lyrate rockcress Locus 16056801

Position : sca3 ( 5`- 4407829 .. 4409520 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056801

Protein [Map View]
MGSNCDGNLKAEIEESNGSSGKKTRVPPCPLDVSTSRRTLIGHGKPRRWSISALPDASSRFQLLKFGSPSAKFKKMAEDR
DEVSRSVKSSSSGSSHNFRERISGVLHRKIDWSSLMKMGKEWIRNPINMALFVWILVVAVSGAILFMVMTGMLNHALPKK
SQRDAWFEVNNQILNGLFTLMCLYQHPKRFYHLVLLCRWKQDDITKLRKAYCKDGTYKPNEWMHIMVVVLLLHLNCFAQY
ALCGLNVGFRRSERPPIGVAICISAAIGAPAVAGLYTILSPLGKDYDDSNEDEENQLQQREEGSVNRRFTLERRYSFASA
STGVGDGMVPVSDPQWSGGILDIWDDISLAYLSLFCTFCVFGWNMERVGFGNMYVHIATFILFCLAPFFIFNLAAVNIDN
ETVREALGISGILLCVFGLLYGGFWRIQMRKRFKLPSYKFCFGRAAIADCALWLCCCWCSLAQEVRTANAYEIVEDKFCQ
RKEEKNLASPNLVSPLPREDGVFDPRFGLGSSPKNISGASSPSPSRFWKEVHSPNIQTPREKEEGKSEVALTPPSPLSIH
REA*

DNA
ATGGGATCGAATTGTGATGGGAATTTGAAAGCAGAGATTGAAGAATCTAATGGTTCTTCTGGCAAAAAAACTAGGGTTCC
TCCTTGTCCTCTTGATGTTTCTACATCTAGAAGAACTTTGATTGGTCATGGTAAACCTAGGAGATGGTCTATTAGTGCTT
TGCCTGATGCTTCTAGTAGATTCCAGCTTCTGAAATTTGGTTCTCCTTCTGCTAAATTCAAGAAAATGGCTGAGGATAGA
GACGAGGTTTCCCGGTCAGTGAAGAGCTCAAGTAGCGGCAGCAGTCATAACTTCAGGGAAAGAATCAGTGGTGTGCTTCA
CCGGAAAATCGATTGGAGTTCTCTGATGAAAATGGGGAAAGAATGGATTAGGAATCCTATTAACATGGCTCTCTTTGTGT
GGATACTTGTTGTTGCAGTCTCTGGTGCTATTCTCTTCATGGTTATGACTGGTATGTTGAATCATGCTTTGCCTAAGAAG
TCACAGAGAGATGCTTGGTTTGAAGTTAACAATCAGATTCTTAATGGGTTGTTTACTTTGATGTGTCTTTATCAACATCC
CAAACGGTTTTATCACTTGGTGCTTCTTTGTAGATGGAAGCAGGATGATATTACAAAGCTTAGGAAAGCTTATTGCAAGG
ACGGGACTTATAAGCCGAATGAATGGATGCACATTATGGTTGTTGTCCTTTTGCTTCACTTGAACTGTTTTGCTCAGTAC
GCGCTTTGTGGTCTTAATGTTGGATTCAGGAGATCAGAGAGACCTCCCATTGGAGTCGCTATATGTATCTCTGCTGCGAT
TGGAGCTCCTGCGGTTGCGGGTTTGTACACTATACTAAGTCCACTTGGGAAAGATTATGATGATTCAAATGAAGACGAGG
AGAATCAACTGCAGCAACGTGAAGAAGGGTCTGTGAATCGCCGGTTTACTTTAGAGAGGAGGTATTCGTTTGCTTCTGCT
TCCACGGGGGTTGGGGATGGAATGGTTCCGGTGAGTGATCCTCAATGGAGTGGTGGAATTTTGGATATTTGGGATGATAT
TTCATTGGCTTATCTTTCCCTTTTCTGCACTTTCTGCGTCTTTGGATGGAACATGGAGAGAGTTGGGTTTGGGAACATGT
ATGTTCACATAGCGACGTTTATTCTCTTTTGTTTGGCACCTTTCTTTATATTCAACTTAGCTGCAGTTAATATCGATAAT
GAGACGGTTAGGGAGGCGCTTGGGATATCTGGAATCCTTCTTTGTGTGTTTGGTTTGCTCTATGGTGGATTCTGGAGAAT
TCAGATGAGGAAAAGATTCAAATTGCCGAGTTATAAGTTCTGCTTCGGTAGAGCCGCGATTGCTGATTGTGCGCTCTGGT
TATGTTGTTGCTGGTGCTCTTTAGCACAAGAAGTTAGGACTGCAAACGCTTATGAGATAGTGGAAGACAAATTCTGCCAA
AGAAAAGAAGAGAAGAATTTGGCATCTCCGAATTTGGTATCTCCTTTGCCTCGTGAGGACGGTGTGTTTGATCCTCGGTT
TGGTCTCGGGAGCTCCCCTAAGAACATAAGTGGAGCTAGTTCTCCTAGCCCGAGCAGGTTTTGGAAAGAGGTACATAGTC
CAAATATTCAGACACCTAGAGAGAAAGAAGAAGGTAAAAGCGAGGTTGCTCTGACTCCACCTTCTCCTCTGTCTATACAC
CGAGAAGCTTGA