Details for Lyrate rockcress Locus 16056593

Position : sca3 ( 5`- 7955407 .. 7951208 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479358 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056593

Protein [Map View]
MEGNFEEQNKLPELKLDAKQAQGFLSFYKTLPNATRAVRFFDRKDYYTAHGENSVFIAKTYYHTTTALRQLGSGSNALSS
VSISKNMFETIARDLLLERNDHTAELYEGSGSNWRLVKTGSPGNIGSFEDVLFANNEMQDTPVVVSIFPSFQDGRCVIGM
AYVDLTRRILGLAEFLDDSRFTNLESSLIALGAKECIFPAESGKSNECKSLYDSLERCAVMITERKKHEFKGRDLDSDLK
RLVKGNIEPVRDLVSGFDLATPALGALLSFSELLSNEDNYGNFTIRRYDIGGFMRLDSAAMRALNVMESKTDANKNFSLF
GLMNRTCTAGMGKRLLHMWLKQPLVDLNEIKTRLDIVQCFVEEAGLRQDLRQHLKRISDVERLLRSLERRRGGLQHIIKL
YQSTIRLPFIKTAMQQYTGEFSPLIRERYLKKLEALSDQDHLGKFIDLVEYSVDLDQLENGEYMISSSYDTTLASLKDQK
ELLEQQIHELHKKTAIELDLQVDKALKLDKAAQFGHVFRITKKEEPKIRKKLTTQFIVLETRKDGVKFTNTKLKKLGDQY
QSVVDDYKSCQKELVDRVVQTVTSFSEVFEELAGLLSEMDVLLSFADLAASCPTPYCRPEVTSSDAGDIVLEGSRHPCVE
AQDWVNFIPNDCRLMRGKSWFQIVTGPNMGGKSTFIRQVGVIVLMAQVGSFVPCDKASISIRDCIFARVGAGDCQLRGVS
TFMQEMLETASILKGATDKSLIIIDELGRGTSTYDGFGLAWAICEHLVQVKKAPTLFATHFHELTALAQSNSEVAGDTVG
VANFHVSAHIDTESRKLTMLYKVEPGACDQSFGIHVAEFANFPESVVALAREKAAELEDFSPSSMIVNNEESGKRKSRED
DPDEVSRGAARAHKFLKEFAAMPLDKMELKDSLQRVRAMKDELEKDAADCHWLRQFL*

DNA
ATGGAGGGCAATTTCGAGGAACAGAACAAGCTTCCGGAGCTGAAATTGGATGCAAAGCAGGCTCAAGGGTTTCTCTCGTT
CTACAAAACCCTACCAAATGCTACGAGAGCTGTTAGATTCTTTGATCGCAAGGATTATTATACAGCTCATGGTGAAAATT
CAGTTTTCATCGCAAAGACTTATTATCATACAACCACTGCTCTACGTCAGCTTGGGAGTGGATCAAATGCTCTTTCAAGT
GTAAGCATTAGTAAGAACATGTTTGAAACGATTGCTAGGGATCTTCTCCTGGAGCGTAATGATCATACCGCAGAACTTTA
TGAGGGAAGTGGATCGAATTGGAGACTTGTGAAAACAGGTTCTCCTGGAAACATTGGAAGCTTTGAAGATGTTTTGTTTG
CAAACAATGAAATGCAGGACACACCAGTTGTTGTCTCCATATTTCCAAGTTTTCAGGATGGAAGATGCGTTATCGGTATG
GCCTATGTTGATCTGACTAGGCGAATTCTTGGACTAGCTGAGTTTCTTGATGATAGCCGCTTCACCAATCTGGAGTCTTC
GCTGATTGCTTTAGGCGCAAAAGAATGCATTTTTCCAGCTGAATCGGGCAAATCCAATGAATGCAAAAGCCTGTATGATT
CTCTGGAGAGGTGTGCCGTGATGATAACAGAGAGGAAGAAACACGAGTTCAAAGGACGAGATTTAGATTCAGATCTTAAG
AGATTGGTGAAGGGGAATATTGAACCTGTTAGAGATTTGGTATCCGGGTTTGACCTTGCGACTCCTGCTCTAGGTGCATT
ACTCTCCTTTTCTGAACTTCTCTCAAATGAGGATAACTATGGGAACTTCACGATCCGCAGATATGATATCGGCGGATTCA
TGAGACTCGACTCTGCAGCTATGAGGGCGTTGAATGTGATGGAGAGCAAAACTGATGCTAATAAGAATTTCAGTTTGTTT
GGTCTCATGAACAGAACATGCACCGCAGGGATGGGTAAGAGACTGCTTCATATGTGGCTGAAGCAACCTCTCGTGGATTT
GAATGAGATTAAGACGAGATTAGATATAGTTCAGTGCTTTGTTGAAGAAGCTGGATTAAGGCAAGATCTTAGACAGCATC
TGAAGCGAATCTCAGATGTTGAGAGGCTTTTGCGCAGTCTCGAGAGAAGAAGAGGTGGGTTACAGCACATTATTAAACTC
TATCAGTCAACTATAAGGCTTCCCTTCATCAAAACAGCTATGCAACAGTACACCGGAGAATTCTCACCACTCATCAGAGA
GAGATACTTGAAAAAGCTTGAGGCGTTATCAGATCAAGATCACCTCGGAAAGTTCATTGATTTGGTTGAGTACTCTGTAG
ATCTTGACCAGCTTGAAAATGGAGAATACATGATATCTTCAAGCTACGACACCACATTGGCATCTCTGAAAGATCAGAAA
GAATTGCTGGAGCAGCAGATTCACGAATTGCACAAAAAGACGGCGATAGAACTCGATCTTCAGGTCGACAAGGCTCTTAA
ACTTGACAAAGCAGCGCAATTTGGGCATGTCTTCAGGATCACGAAGAAGGAAGAGCCAAAGATCAGGAAGAAGCTGACGA
CACAGTTTATAGTGCTAGAGACTCGCAAAGACGGAGTGAAGTTCACAAACACAAAGCTTAAGAAACTGGGGGACCAGTAC
CAAAGTGTTGTGGATGATTATAAGAGCTGTCAGAAGGAGCTTGTTGATCGTGTAGTTCAGACTGTTACCAGCTTCTCCGA
GGTGTTTGAGGAGTTAGCTGGGTTGCTCTCTGAAATGGATGTTTTGTTAAGCTTCGCTGATTTGGCTGCCAGTTGCCCTA
CTCCATACTGTAGGCCAGAAGTCACCTCTTCGGATGCTGGAGATATTGTATTAGAAGGAAGCAGACATCCATGCGTAGAA
GCTCAAGATTGGGTGAATTTTATACCAAATGATTGCAGACTCATGAGAGGGAAGAGTTGGTTTCAAATAGTAACAGGGCC
TAACATGGGAGGAAAGTCCACTTTCATTCGCCAGGTTGGTGTGATTGTGCTGATGGCTCAAGTTGGTTCCTTTGTTCCTT
GTGATAAAGCATCAATTTCCATCAGAGACTGCATCTTTGCCCGTGTAGGAGCAGGCGATTGCCAACTGCGTGGAGTGTCT
ACTTTTATGCAAGAAATGCTTGAAACCGCATCGATATTGAAAGGTGCTACAGATAAGTCACTGATAATTATCGATGAACT
TGGTCGTGGAACATCAACTTATGATGGTTTTGGTTTAGCTTGGGCTATATGTGAGCATCTTGTTCAAGTGAAGAAAGCAC
CAACTCTATTTGCTACTCACTTCCATGAACTTACTGCCTTGGCTCAATCAAACTCTGAGGTCGCTGGTGACACCGTTGGT
GTGGCAAACTTCCATGTCAGCGCTCACATTGACACTGAAAGCCGCAAACTCACCATGCTTTACAAGGTTGAACCAGGGGC
CTGTGACCAGAGCTTTGGGATTCATGTGGCGGAATTTGCCAACTTCCCTGAAAGCGTAGTGGCCCTCGCAAGAGAGAAAG
CAGCAGAACTGGAAGATTTCTCTCCGTCTTCCATGATAGTCAACAATGAGGAGAGTGGGAAGAGAAAGAGCAGAGAAGAT
GATCCAGATGAAGTATCAAGAGGGGCAGCGCGAGCTCACAAGTTTCTGAAAGAGTTTGCAGCGATGCCACTTGATAAAAT
GGAGCTTAAAGATTCACTTCAACGGGTACGTGCGATGAAAGATGAGCTAGAGAAAGATGCTGCAGACTGCCACTGGCTCA
GGCAGTTCCTGTGA